![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
PI0015387 (gene) Melon (PI 482460) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGATTTCCACATTTTTGGGCTGTAAGATTTCGGTTCCGCCATTGTTGAACTCATCTGCAAGCAAAGCAGCTCCATGCTCCGGCGGAATTTGTTGATTGAATGCTCGTCGAGGCCAAACAAGAAGGCGACAGCACATCACATGAAAACGAGGCCACGGAAATCTCAGCCATGGGACATTCGGCGTAAGCCGACTGTGTATCCTCCTCTGCCGCCTCTTCCAGCAGACTGGACCTTGGTCTCATCCGTCTCCGGCGATGAAAATGTCGAGATAGCCTCGATTTCTTCGTCTGCTCAAGCACCGCTTACTAGCGAGTAA ATGTCGATTTCCACATTTTTGGGCTGTAAGATTTCGGTTCCGCCATTGTTGAACTCATCTGCAAGCAAAGCAGCTCCATGCTCCGGCGGAATTTCACATCACATGAAAACGAGGCCACGGAAATCTCAGCCATGGGACATTCGGCGTAAGCCGACTGTGTATCCTCCTCTGCCGCCTCTTCCAGCAGACTGGACCTTGGTCTCATCCGTCTCCGGCGATGAAAATGTCGAGATAGCCTCGATTTCTTCGTCTGCTCAAGCACCGCTTACTAGCGAGTAA ATGTCGATTTCCACATTTTTGGGCTGTAAGATTTCGGTTCCGCCATTGTTGAACTCATCTGCAAGCAAAGCAGCTCCATGCTCCGGCGGAATTTCACATCACATGAAAACGAGGCCACGGAAATCTCAGCCATGGGACATTCGGCGTAAGCCGACTGTGTATCCTCCTCTGCCGCCTCTTCCAGCAGACTGGACCTTGGTCTCATCCGTCTCCGGCGATGAAAATGTCGAGATAGCCTCGATTTCTTCGTCTGCTCAAGCACCGCTTACTAGCGAGTAA MSISTFLGCKISVPPLLNSSASKAAPCSGGISHHMKTRPRKSQPWDIRRKPTVYPPLPPLPADWTLVSSVSGDENVEIASISSSAQAPLTSE Homology
BLAST of PI0015387 vs. ExPASy Swiss-Prot
Match: P82411 (50S ribosomal protein 6, chloroplastic OS=Spinacia oleracea OX=3562 GN=PSRP6 PE=1 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.2e-13 Identity = 43/111 (38.74%), Postives = 63/111 (56.76%), Query Frame = 0
BLAST of PI0015387 vs. ExPASy Swiss-Prot
Match: Q9FKP0 (50S ribosomal protein 6, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PSRP6 PE=3 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 4.3e-11 Identity = 30/55 (54.55%), Postives = 38/55 (69.09%), Query Frame = 0
BLAST of PI0015387 vs. ExPASy Swiss-Prot
Match: P11892 (50S ribosomal protein 6, chloroplastic OS=Pisum sativum OX=3888 GN=PSRP6 PE=3 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 1.2e-08 Identity = 37/85 (43.53%), Postives = 47/85 (55.29%), Query Frame = 0
BLAST of PI0015387 vs. ExPASy TrEMBL
Match: A0A0A0LHS7 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G894500 PE=4 SV=1) HSP 1 Score: 165.2 bits (417), Expect = 1.3e-37 Identity = 87/106 (82.08%), Postives = 89/106 (83.96%), Query Frame = 0
BLAST of PI0015387 vs. ExPASy TrEMBL
Match: A0A5A7TB88 (50S ribosomal protein 6 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold455G005220 PE=4 SV=1) HSP 1 Score: 164.1 bits (414), Expect = 2.8e-37 Identity = 86/106 (81.13%), Postives = 88/106 (83.02%), Query Frame = 0
BLAST of PI0015387 vs. ExPASy TrEMBL
Match: A0A1S3CQF4 (50S ribosomal protein 6, chloroplastic OS=Cucumis melo OX=3656 GN=LOC103503622 PE=4 SV=1) HSP 1 Score: 164.1 bits (414), Expect = 2.8e-37 Identity = 86/106 (81.13%), Postives = 88/106 (83.02%), Query Frame = 0
BLAST of PI0015387 vs. ExPASy TrEMBL
Match: A0A6J1IDX3 (50S ribosomal protein 6, chloroplastic OS=Cucurbita maxima OX=3661 GN=LOC111476133 PE=4 SV=1) HSP 1 Score: 141.7 bits (356), Expect = 1.5e-30 Identity = 77/107 (71.96%), Postives = 84/107 (78.50%), Query Frame = 0
BLAST of PI0015387 vs. ExPASy TrEMBL
Match: A0A6J1F7W7 (50S ribosomal protein 6, chloroplastic-like OS=Cucurbita moschata OX=3662 GN=LOC111442914 PE=4 SV=1) HSP 1 Score: 140.6 bits (353), Expect = 3.3e-30 Identity = 76/107 (71.03%), Postives = 83/107 (77.57%), Query Frame = 0
BLAST of PI0015387 vs. NCBI nr
Match: XP_011652886.1 (50S ribosomal protein 6, chloroplastic [Cucumis sativus]) HSP 1 Score: 165.2 bits (417), Expect = 2.6e-37 Identity = 87/106 (82.08%), Postives = 89/106 (83.96%), Query Frame = 0
BLAST of PI0015387 vs. NCBI nr
Match: XP_008466097.1 (PREDICTED: 50S ribosomal protein 6, chloroplastic [Cucumis melo] >KAA0038635.1 50S ribosomal protein 6 [Cucumis melo var. makuwa] >TYK31235.1 50S ribosomal protein 6 [Cucumis melo var. makuwa]) HSP 1 Score: 164.1 bits (414), Expect = 5.8e-37 Identity = 86/106 (81.13%), Postives = 88/106 (83.02%), Query Frame = 0
BLAST of PI0015387 vs. NCBI nr
Match: XP_023536142.1 (50S ribosomal protein 6, chloroplastic-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 142.5 bits (358), Expect = 1.8e-30 Identity = 77/107 (71.96%), Postives = 84/107 (78.50%), Query Frame = 0
BLAST of PI0015387 vs. NCBI nr
Match: XP_022975752.1 (50S ribosomal protein 6, chloroplastic [Cucurbita maxima]) HSP 1 Score: 141.7 bits (356), Expect = 3.1e-30 Identity = 77/107 (71.96%), Postives = 84/107 (78.50%), Query Frame = 0
BLAST of PI0015387 vs. NCBI nr
Match: XP_022936242.1 (50S ribosomal protein 6, chloroplastic-like [Cucurbita moschata]) HSP 1 Score: 140.6 bits (353), Expect = 6.8e-30 Identity = 76/107 (71.03%), Postives = 83/107 (77.57%), Query Frame = 0
BLAST of PI0015387 vs. TAIR 10
Match: AT5G17870.1 (plastid-specific 50S ribosomal protein 6 ) HSP 1 Score: 68.6 bits (166), Expect = 3.1e-12 Identity = 30/55 (54.55%), Postives = 38/55 (69.09%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (PI 482460) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|