
PI0015341 (gene) Melon (PI 482460) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATCCACTGATTTCTGTCGCTTTCGTTATTGCTGCTGGGTTGGCCGTCAGGCTTGCTTCTATTGGACCTGGGGTTGGTCAAGGTACTGCTGCGTGCCAAGTTGTAGAAGGGATCGCAAGACAACCTGAGGCGGAGGGAAAAATCAAAGGTACTTTATTGCTTAGTCTGGCTTTTATGGAAGCTTTAACAATTTATGGACTGGTTGTAGCATTAGCACTTTTATTTACGAATCCTTTTGTTTAA ATGAATCCACTGATTTCTGTCGCTTTCGTTATTGCTGCTGGGTTGGCCGTCAGGCTTGCTTCTATTGGACCTGGGGTTGGTCAAGGTACTGCTGCGTGCCAAGTTGTAGAAGGGATCGCAAGACAACCTGAGGCGGAGGGAAAAATCAAAGGTACTTTATTGCTTAGTCTGGCTTTTATGGAAGCTTTAACAATTTATGGACTGGTTGTAGCATTAGCACTTTTATTTACGAATCCTTTTGTTTAA ATGAATCCACTGATTTCTGTCGCTTTCGTTATTGCTGCTGGGTTGGCCGTCAGGCTTGCTTCTATTGGACCTGGGGTTGGTCAAGGTACTGCTGCGTGCCAAGTTGTAGAAGGGATCGCAAGACAACCTGAGGCGGAGGGAAAAATCAAAGGTACTTTATTGCTTAGTCTGGCTTTTATGGAAGCTTTAACAATTTATGGACTGGTTGTAGCATTAGCACTTTTATTTACGAATCCTTTTGTTTAA MNPLISVAFVIAAGLAVRLASIGPGVGQGTAACQVVEGIARQPEAEGKIKGTLLLSLAFMEALTIYGLVVALALLFTNPFV Homology
BLAST of PI0015341 vs. ExPASy Swiss-Prot
Match: Q4FGF2 (ATP synthase subunit c, chloroplastic OS=Acorus americanus OX=263995 GN=atpH PE=3 SV=1) HSP 1 Score: 130.6 bits (327), Expect = 8.2e-30 Identity = 74/81 (91.36%), Postives = 75/81 (92.59%), Query Frame = 0
BLAST of PI0015341 vs. ExPASy Swiss-Prot
Match: Q3V547 (ATP synthase subunit c, chloroplastic OS=Acorus calamus OX=4465 GN=atpH PE=3 SV=1) HSP 1 Score: 130.6 bits (327), Expect = 8.2e-30 Identity = 74/81 (91.36%), Postives = 75/81 (92.59%), Query Frame = 0
BLAST of PI0015341 vs. ExPASy Swiss-Prot
Match: Q85FN2 (ATP synthase subunit c, chloroplastic OS=Adiantum capillus-veneris OX=13818 GN=atpH PE=2 SV=2) HSP 1 Score: 130.6 bits (327), Expect = 8.2e-30 Identity = 74/81 (91.36%), Postives = 75/81 (92.59%), Query Frame = 0
BLAST of PI0015341 vs. ExPASy Swiss-Prot
Match: A4QJA2 (ATP synthase subunit c, chloroplastic OS=Aethionema cordifolium OX=434059 GN=atpH PE=3 SV=1) HSP 1 Score: 130.6 bits (327), Expect = 8.2e-30 Identity = 74/81 (91.36%), Postives = 75/81 (92.59%), Query Frame = 0
BLAST of PI0015341 vs. ExPASy Swiss-Prot
Match: A4QJI6 (ATP synthase subunit c, chloroplastic OS=Aethionema grandiflorum OX=72657 GN=atpH PE=3 SV=1) HSP 1 Score: 130.6 bits (327), Expect = 8.2e-30 Identity = 74/81 (91.36%), Postives = 75/81 (92.59%), Query Frame = 0
BLAST of PI0015341 vs. ExPASy TrEMBL
Match: K9L5P5 (ATP synthase F0 sector subunit C OS=Chrysanthemum morifolium OX=41568 GN=atpH PE=3 SV=1) HSP 1 Score: 130.6 bits (327), Expect = 3.0e-27 Identity = 74/81 (91.36%), Postives = 75/81 (92.59%), Query Frame = 0
BLAST of PI0015341 vs. ExPASy TrEMBL
Match: A0A6H1XHY6 (ATP synthase subunit c, chloroplastic OS=Lycoris aurea OX=152838 GN=atpH PE=3 SV=1) HSP 1 Score: 130.6 bits (327), Expect = 3.0e-27 Identity = 74/81 (91.36%), Postives = 75/81 (92.59%), Query Frame = 0
BLAST of PI0015341 vs. ExPASy TrEMBL
Match: A0A076E6X0 (ATP synthase subunit c, chloroplastic OS=Salix interior OX=75712 GN=atpH PE=3 SV=1) HSP 1 Score: 130.6 bits (327), Expect = 3.0e-27 Identity = 74/81 (91.36%), Postives = 75/81 (92.59%), Query Frame = 0
BLAST of PI0015341 vs. ExPASy TrEMBL
Match: A0A7H0R0V7 (ATP synthase subunit c, chloroplastic OS=Aster flaccidus OX=1196477 GN=atpH PE=3 SV=1) HSP 1 Score: 130.6 bits (327), Expect = 3.0e-27 Identity = 74/81 (91.36%), Postives = 75/81 (92.59%), Query Frame = 0
BLAST of PI0015341 vs. ExPASy TrEMBL
Match: A0A075TPW4 (ATP synthase F0 sector subunit C OS=Camellia reticulata OX=452972 GN=atpH PE=3 SV=1) HSP 1 Score: 130.6 bits (327), Expect = 3.0e-27 Identity = 74/81 (91.36%), Postives = 75/81 (92.59%), Query Frame = 0
BLAST of PI0015341 vs. NCBI nr
Match: KAF3776839.1 (ATP synthase subunit alpha [Nymphaea thermarum]) HSP 1 Score: 130.6 bits (327), Expect = 6.2e-27 Identity = 74/81 (91.36%), Postives = 75/81 (92.59%), Query Frame = 0
BLAST of PI0015341 vs. NCBI nr
Match: YP_009627550.1 (ATP synthase CF0 C subunit [Allium chrysocephalum] >YP_009627808.1 ATP synthase CF0 C subunit [Allium rude] >QBO26280.1 ATP synthase CF0 C subunit [Allium chrysocephalum] >QBO26538.1 ATP synthase CF0 C subunit [Allium rude]) HSP 1 Score: 130.6 bits (327), Expect = 6.2e-27 Identity = 74/81 (91.36%), Postives = 75/81 (92.59%), Query Frame = 0
BLAST of PI0015341 vs. NCBI nr
Match: RYQ79638.1 (hypothetical protein Ahy_Scaffold2g107587 isoform B [Arachis hypogaea]) HSP 1 Score: 130.6 bits (327), Expect = 6.2e-27 Identity = 73/81 (90.12%), Postives = 76/81 (93.83%), Query Frame = 0
BLAST of PI0015341 vs. NCBI nr
Match: KAD4981683.1 (hypothetical protein E3N88_18354 [Mikania micrantha]) HSP 1 Score: 130.6 bits (327), Expect = 6.2e-27 Identity = 74/81 (91.36%), Postives = 75/81 (92.59%), Query Frame = 0
BLAST of PI0015341 vs. NCBI nr
Match: ONK65900.1 (uncharacterized protein A4U43_C06F2130 [Asparagus officinalis]) HSP 1 Score: 130.6 bits (327), Expect = 6.2e-27 Identity = 74/81 (91.36%), Postives = 75/81 (92.59%), Query Frame = 0
BLAST of PI0015341 vs. TAIR 10
Match: ATCG00140.1 (ATP synthase subunit C family protein ) HSP 1 Score: 130.2 bits (326), Expect = 7.6e-31 Identity = 73/81 (90.12%), Postives = 75/81 (92.59%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (PI 482460) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|