
PI0015215 (gene) Melon (PI 482460) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACGAGAGTGGTGGTCGTGGAAGAGGTTATGCGGACGACTCGATGATGGCCGGAGGCAGCAGAGAGATTCGTTACCGAGGAGTACGACGTCGGCCATGGGGAAAATTCGCAGCTGAAATACGAGACTCTAGAAGGCAAGGAGTACGGATATGGCTAGGAACTTTCAACACAGCGGAAGAAGCAGCACGAGCTTACGATCGAGCGGCTTACAACATGAGAGGTCATTTGGCCATTTTGAATTTTCCTAATGAATATCCGCTTACCAGCTCTGGCGGCGGTGGTGCTTATTCGAGTGGGTCGTCGTCTTCTTCTTCAATGTCAATGCGGCAAAATGAAGTGATTGAATTTGAGTATTTGGATGATAAAGTGCTGGAAGATCTTCTTGACTATGGAGAAGAAAGTGATAAGAGAAGCTAA ATGGACGAGAGTGGTGGTCGTGGAAGAGGTTATGCGGACGACTCGATGATGGCCGGAGGCAGCAGAGAGATTCGTTACCGAGGAGTACGACGTCGGCCATGGGGAAAATTCGCAGCTGAAATACGAGACTCTAGAAGGCAAGGAGTACGGATATGGCTAGGAACTTTCAACACAGCGGAAGAAGCAGCACGAGCTTACGATCGAGCGGCTTACAACATGAGAGGTCATTTGGCCATTTTGAATTTTCCTAATGAATATCCGCTTACCAGCTCTGGCGGCGGTGGTGCTTATTCGAGTGGGTCGTCGTCTTCTTCTTCAATGTCAATGCGGCAAAATGAAGTGATTGAATTTGAGTATTTGGATGATAAAGTGCTGGAAGATCTTCTTGACTATGGAGAAGAAAGTGATAAGAGAAGCTAA ATGGACGAGAGTGGTGGTCGTGGAAGAGGTTATGCGGACGACTCGATGATGGCCGGAGGCAGCAGAGAGATTCGTTACCGAGGAGTACGACGTCGGCCATGGGGAAAATTCGCAGCTGAAATACGAGACTCTAGAAGGCAAGGAGTACGGATATGGCTAGGAACTTTCAACACAGCGGAAGAAGCAGCACGAGCTTACGATCGAGCGGCTTACAACATGAGAGGTCATTTGGCCATTTTGAATTTTCCTAATGAATATCCGCTTACCAGCTCTGGCGGCGGTGGTGCTTATTCGAGTGGGTCGTCGTCTTCTTCTTCAATGTCAATGCGGCAAAATGAAGTGATTGAATTTGAGTATTTGGATGATAAAGTGCTGGAAGATCTTCTTGACTATGGAGAAGAAAGTGATAAGAGAAGCTAA MDESGGRGRGYADDSMMAGGSREIRYRGVRRRPWGKFAAEIRDSRRQGVRIWLGTFNTAEEAARAYDRAAYNMRGHLAILNFPNEYPLTSSGGGGAYSSGSSSSSSMSMRQNEVIEFEYLDDKVLEDLLDYGEESDKRS Homology
BLAST of PI0015215 vs. ExPASy Swiss-Prot
Match: Q9LTC6 (Ethylene-responsive transcription factor ERF095 OS=Arabidopsis thaliana OX=3702 GN=ERF095 PE=1 SV=1) HSP 1 Score: 146.4 bits (368), Expect = 2.5e-34 Identity = 75/123 (60.98%), Postives = 93/123 (75.61%), Query Frame = 0
BLAST of PI0015215 vs. ExPASy Swiss-Prot
Match: Q9LTC5 (Ethylene-responsive transcription factor ERF098 OS=Arabidopsis thaliana OX=3702 GN=ERF098 PE=1 SV=1) HSP 1 Score: 146.0 bits (367), Expect = 3.2e-34 Identity = 79/123 (64.23%), Postives = 89/123 (72.36%), Query Frame = 0
BLAST of PI0015215 vs. ExPASy Swiss-Prot
Match: P93822 (Ethylene-responsive transcription factor 14 OS=Arabidopsis thaliana OX=3702 GN=ERF14 PE=2 SV=1) HSP 1 Score: 144.4 bits (363), Expect = 9.4e-34 Identity = 79/135 (58.52%), Postives = 100/135 (74.07%), Query Frame = 0
BLAST of PI0015215 vs. ExPASy Swiss-Prot
Match: Q9LSX0 (Ethylene-responsive transcription factor ERF096 OS=Arabidopsis thaliana OX=3702 GN=ERF096 PE=1 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 8.0e-33 Identity = 79/136 (58.09%), Postives = 97/136 (71.32%), Query Frame = 0
BLAST of PI0015215 vs. ExPASy Swiss-Prot
Match: O04681 (Pathogenesis-related genes transcriptional activator PTI5 OS=Solanum lycopersicum OX=4081 GN=PTI5 PE=2 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 1.2e-20 Identity = 57/101 (56.44%), Postives = 70/101 (69.31%), Query Frame = 0
BLAST of PI0015215 vs. ExPASy TrEMBL
Match: A0A5A7U6W8 (Ethylene-responsive transcription factor ERF096 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold434G001520 PE=4 SV=1) HSP 1 Score: 254.6 bits (649), Expect = 2.4e-64 Identity = 134/140 (95.71%), Postives = 136/140 (97.14%), Query Frame = 0
BLAST of PI0015215 vs. ExPASy TrEMBL
Match: A0A1S3AW98 (ethylene-responsive transcription factor ERF096 OS=Cucumis melo OX=3656 GN=LOC103483602 PE=4 SV=1) HSP 1 Score: 251.5 bits (641), Expect = 2.0e-63 Identity = 133/140 (95.00%), Postives = 135/140 (96.43%), Query Frame = 0
BLAST of PI0015215 vs. ExPASy TrEMBL
Match: A0A0A0L9V5 (AP2/ERF domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_3G135630 PE=4 SV=1) HSP 1 Score: 245.4 bits (625), Expect = 1.4e-61 Identity = 130/139 (93.53%), Postives = 130/139 (93.53%), Query Frame = 0
BLAST of PI0015215 vs. ExPASy TrEMBL
Match: A0A6J1IV86 (ethylene-responsive transcription factor ERF096 OS=Cucurbita maxima OX=3661 GN=LOC111479589 PE=4 SV=1) HSP 1 Score: 237.3 bits (604), Expect = 3.9e-59 Identity = 123/139 (88.49%), Postives = 128/139 (92.09%), Query Frame = 0
BLAST of PI0015215 vs. ExPASy TrEMBL
Match: A0A6J1E9T0 (ethylene-responsive transcription factor ERF096-like OS=Cucurbita moschata OX=3662 GN=LOC111432142 PE=4 SV=1) HSP 1 Score: 236.5 bits (602), Expect = 6.7e-59 Identity = 122/139 (87.77%), Postives = 129/139 (92.81%), Query Frame = 0
BLAST of PI0015215 vs. NCBI nr
Match: KAA0049259.1 (ethylene-responsive transcription factor ERF096 [Cucumis melo var. makuwa] >TYK17298.1 ethylene-responsive transcription factor ERF096 [Cucumis melo var. makuwa]) HSP 1 Score: 254.6 bits (649), Expect = 4.9e-64 Identity = 134/140 (95.71%), Postives = 136/140 (97.14%), Query Frame = 0
BLAST of PI0015215 vs. NCBI nr
Match: XP_038877364.1 (ethylene-responsive transcription factor ERF096 [Benincasa hispida]) HSP 1 Score: 253.4 bits (646), Expect = 1.1e-63 Identity = 134/142 (94.37%), Postives = 135/142 (95.07%), Query Frame = 0
BLAST of PI0015215 vs. NCBI nr
Match: XP_008438537.1 (PREDICTED: ethylene-responsive transcription factor ERF096 [Cucumis melo]) HSP 1 Score: 251.5 bits (641), Expect = 4.2e-63 Identity = 133/140 (95.00%), Postives = 135/140 (96.43%), Query Frame = 0
BLAST of PI0015215 vs. NCBI nr
Match: XP_004134413.1 (ethylene-responsive transcription factor 14 [Cucumis sativus] >KGN56866.1 hypothetical protein Csa_010465 [Cucumis sativus]) HSP 1 Score: 245.4 bits (625), Expect = 3.0e-61 Identity = 130/139 (93.53%), Postives = 130/139 (93.53%), Query Frame = 0
BLAST of PI0015215 vs. NCBI nr
Match: XP_023529041.1 (ethylene-responsive transcription factor ERF096-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 237.7 bits (605), Expect = 6.2e-59 Identity = 121/139 (87.05%), Postives = 130/139 (93.53%), Query Frame = 0
BLAST of PI0015215 vs. TAIR 10
Match: AT3G23220.1 (Integrase-type DNA-binding superfamily protein ) HSP 1 Score: 146.4 bits (368), Expect = 1.8e-35 Identity = 75/123 (60.98%), Postives = 93/123 (75.61%), Query Frame = 0
BLAST of PI0015215 vs. TAIR 10
Match: AT3G23230.1 (Integrase-type DNA-binding superfamily protein ) HSP 1 Score: 146.0 bits (367), Expect = 2.3e-35 Identity = 79/123 (64.23%), Postives = 89/123 (72.36%), Query Frame = 0
BLAST of PI0015215 vs. TAIR 10
Match: AT1G04370.1 (Ethylene-responsive element binding factor 14 ) HSP 1 Score: 144.4 bits (363), Expect = 6.7e-35 Identity = 79/135 (58.52%), Postives = 100/135 (74.07%), Query Frame = 0
BLAST of PI0015215 vs. TAIR 10
Match: AT5G43410.1 (Integrase-type DNA-binding superfamily protein ) HSP 1 Score: 141.4 bits (355), Expect = 5.7e-34 Identity = 79/136 (58.09%), Postives = 97/136 (71.32%), Query Frame = 0
BLAST of PI0015215 vs. TAIR 10
Match: AT1G06160.1 (octadecanoid-responsive Arabidopsis AP2/ERF 59 ) HSP 1 Score: 100.1 bits (248), Expect = 1.4e-21 Identity = 45/70 (64.29%), Postives = 58/70 (82.86%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (PI 482460) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|