
PI0010402 (gene) Melon (PI 482460) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGTCACATGGCATAGTTTTAGGCCATTTAGTATCTTCCAAAGGAATAGAAGTAGATAAAGCAAAAATTGACATTATCCAAAAATTGTCATATCCTACCTGTCTAAAAGACATTAGATCTTTTCTTGGTAGCACCGGTTTTTATAGAAGATTCATTAAAGATTTTTCTAAAATTGCTTTACCTCTAACTTCTCTCCTACAAAAAGACATGCCATTTGTGATAGATGAGAAATGCAAAAAAGCGTTCAATGAACTCAAACAAAGGTTAGCTTCTACTCCTATACTTCAATCTCCTAATTGA ATGGTGTCACATGATAAAGCAAAAATTGACATTATCCAAAAATTGTCATATCCTACCTGTCTAAAAGACATTAGATCTTTTCTTGGTAGCACCGGTTTTTATAGAAGATTCATTAAAGATTTTTCTAAAATTGCTTTACCTCTAACTTCTCTCCTACAAAAAGACATGCCATTTGTGATAGATGAGAAATGCAAAAAAGCGTTCAATGAACTCAAACAAAGGTTAGCTTCTACTCCTATACTTCAATCTCCTAATTGA ATGGTGTCACATGATAAAGCAAAAATTGACATTATCCAAAAATTGTCATATCCTACCTGTCTAAAAGACATTAGATCTTTTCTTGGTAGCACCGGTTTTTATAGAAGATTCATTAAAGATTTTTCTAAAATTGCTTTACCTCTAACTTCTCTCCTACAAAAAGACATGCCATTTGTGATAGATGAGAAATGCAAAAAAGCGTTCAATGAACTCAAACAAAGGTTAGCTTCTACTCCTATACTTCAATCTCCTAATTGA MVSHDKAKIDIIQKLSYPTCLKDIRSFLGSTGFYRRFIKDFSKIALPLTSLLQKDMPFVIDEKCKKAFNELKQRLASTPILQSPN Homology
BLAST of PI0010402 vs. ExPASy Swiss-Prot
Match: Q8I7P9 (Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 5.2e-11 Identity = 33/94 (35.11%), Postives = 55/94 (58.51%), Query Frame = 0
BLAST of PI0010402 vs. ExPASy Swiss-Prot
Match: P04323 (Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 1.2e-10 Identity = 34/79 (43.04%), Postives = 52/79 (65.82%), Query Frame = 0
BLAST of PI0010402 vs. ExPASy Swiss-Prot
Match: P10394 (Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster OX=7227 GN=POL PE=4 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 3.7e-09 Identity = 30/81 (37.04%), Postives = 47/81 (58.02%), Query Frame = 0
BLAST of PI0010402 vs. ExPASy Swiss-Prot
Match: P03359 (Gag-Pol polyprotein OS=Woolly monkey sarcoma virus OX=11970 GN=pol PE=3 SV=2) HSP 1 Score: 61.6 bits (148), Expect = 4.9e-09 Identity = 28/74 (37.84%), Postives = 46/74 (62.16%), Query Frame = 0
BLAST of PI0010402 vs. ExPASy Swiss-Prot
Match: P92523 (Uncharacterized mitochondrial protein AtMg00860 OS=Arabidopsis thaliana OX=3702 GN=AtMg00860 PE=4 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 6.4e-09 Identity = 33/84 (39.29%), Postives = 48/84 (57.14%), Query Frame = 0
BLAST of PI0010402 vs. ExPASy TrEMBL
Match: A0A151QL68 (Transposon Ty3-G Gag-Pol polyprotein OS=Cajanus cajan OX=3821 GN=KK1_049186 PE=4 SV=1) HSP 1 Score: 117.9 bits (294), Expect = 2.1e-23 Identity = 55/81 (67.90%), Postives = 64/81 (79.01%), Query Frame = 0
BLAST of PI0010402 vs. ExPASy TrEMBL
Match: A0A392MXJ5 (Uncharacterized protein (Fragment) OS=Trifolium medium OX=97028 PE=4 SV=1) HSP 1 Score: 117.9 bits (294), Expect = 2.1e-23 Identity = 53/81 (65.43%), Postives = 68/81 (83.95%), Query Frame = 0
BLAST of PI0010402 vs. ExPASy TrEMBL
Match: A0A2U1NRI2 (Reverse transcriptase OS=Artemisia annua OX=35608 GN=CTI12_AA230240 PE=4 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 1.4e-22 Identity = 54/81 (66.67%), Postives = 65/81 (80.25%), Query Frame = 0
BLAST of PI0010402 vs. ExPASy TrEMBL
Match: A0A371IAU2 (Retrovirus-related Pol polyprotein (Fragment) OS=Mucuna pruriens OX=157652 GN=pol PE=4 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 1.4e-22 Identity = 53/81 (65.43%), Postives = 64/81 (79.01%), Query Frame = 0
BLAST of PI0010402 vs. ExPASy TrEMBL
Match: A0A2K3NDP5 (RT_RNaseH_2 domain-containing protein (Fragment) OS=Trifolium pratense OX=57577 GN=L195_g024451 PE=4 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 1.8e-22 Identity = 53/81 (65.43%), Postives = 64/81 (79.01%), Query Frame = 0
BLAST of PI0010402 vs. NCBI nr
Match: XP_021603241.1 (uncharacterized protein LOC110608326 [Manihot esculenta]) HSP 1 Score: 122.1 bits (305), Expect = 2.3e-24 Identity = 53/81 (65.43%), Postives = 68/81 (83.95%), Query Frame = 0
BLAST of PI0010402 vs. NCBI nr
Match: XP_028802716.1 (uncharacterized protein LOC114757797 [Prosopis alba]) HSP 1 Score: 120.2 bits (300), Expect = 8.8e-24 Identity = 55/81 (67.90%), Postives = 68/81 (83.95%), Query Frame = 0
BLAST of PI0010402 vs. NCBI nr
Match: XP_028798815.1 (LOW QUALITY PROTEIN: uncharacterized protein LOC114754213 [Prosopis alba]) HSP 1 Score: 119.8 bits (299), Expect = 1.2e-23 Identity = 55/81 (67.90%), Postives = 68/81 (83.95%), Query Frame = 0
BLAST of PI0010402 vs. NCBI nr
Match: XP_028797073.1 (LOW QUALITY PROTEIN: uncharacterized protein LOC114752508 [Prosopis alba]) HSP 1 Score: 119.8 bits (299), Expect = 1.2e-23 Identity = 55/81 (67.90%), Postives = 68/81 (83.95%), Query Frame = 0
BLAST of PI0010402 vs. NCBI nr
Match: XP_019183635.1 (PREDICTED: uncharacterized protein LOC109178455 [Ipomoea nil]) HSP 1 Score: 119.8 bits (299), Expect = 1.2e-23 Identity = 55/81 (67.90%), Postives = 66/81 (81.48%), Query Frame = 0
BLAST of PI0010402 vs. TAIR 10
Match: ATMG00860.1 (DNA/RNA polymerases superfamily protein ) HSP 1 Score: 61.2 bits (147), Expect = 4.5e-10 Identity = 33/84 (39.29%), Postives = 48/84 (57.14%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (PI 482460) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|