
Moc11g13190 (gene) Bitter gourd (OHB3-1) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTTCATCTGTGGCGAATGCTCCCCGGCAGAACGATGCCCTACTCCAAGGTCCAAAAGACGATAACATAGTCGGTGGTTGGACCCCAATCGAGAATGTCGAGGAGAATTCATACGTGCAAGAGATCGGAAGGTTCGCAGTGATGGAGCACAACAAGCAAACAGGGAACCATCTAAAGTTCTTGAAGGTGACGAAAGGTTGGAGTCAAGTGGTGGCTGGAACTAATTACCGTCTCATTTTGGAGGCAGTAAATATGGCTGGGATGATTTGGAATTATGAGGCTGTGGTGTGGGATAAGCCATGGGAGCACTCCTGGACGCTCATATCATTTATTCCTCTCCTCAAGAACTGA ATGAGTTCATCTGTGGCGAATGCTCCCCGGCAGAACGATGCCCTACTCCAAGGTCCAAAAGACGATAACATAGTCGGTGGTTGGACCCCAATCGAGAATGTCGAGGAGAATTCATACGTGCAAGAGATCGGAAGGTTCGCAGTGATGGAGCACAACAAGCAAACAGGGAACCATCTAAAGTTCTTGAAGGTGACGAAAGGTTGGAGTCAAGTGGTGGCTGGAACTAATTACCGTCTCATTTTGGAGGCAGTAAATATGGCTGGGATGATTTGGAATTATGAGGCTGTGGTGTGGGATAAGCCATGGGAGCACTCCTGGACGCTCATATCATTTATTCCTCTCCTCAAGAACTGA ATGAGTTCATCTGTGGCGAATGCTCCCCGGCAGAACGATGCCCTACTCCAAGGTCCAAAAGACGATAACATAGTCGGTGGTTGGACCCCAATCGAGAATGTCGAGGAGAATTCATACGTGCAAGAGATCGGAAGGTTCGCAGTGATGGAGCACAACAAGCAAACAGGGAACCATCTAAAGTTCTTGAAGGTGACGAAAGGTTGGAGTCAAGTGGTGGCTGGAACTAATTACCGTCTCATTTTGGAGGCAGTAAATATGGCTGGGATGATTTGGAATTATGAGGCTGTGGTGTGGGATAAGCCATGGGAGCACTCCTGGACGCTCATATCATTTATTCCTCTCCTCAAGAACTGA MSSSVANAPRQNDALLQGPKDDNIVGGWTPIENVEENSYVQEIGRFAVMEHNKQTGNHLKFLKVTKGWSQVVAGTNYRLILEAVNMAGMIWNYEAVVWDKPWEHSWTLISFIPLLKN Homology
BLAST of Moc11g13190 vs. NCBI nr
Match: XP_022153704.1 (cysteine proteinase inhibitor 1-like [Momordica charantia] >XP_022153705.1 cysteine proteinase inhibitor 1-like [Momordica charantia]) HSP 1 Score: 248.4 bits (633), Expect = 3.0e-62 Identity = 117/117 (100.00%), Postives = 117/117 (100.00%), Query Frame = 0
BLAST of Moc11g13190 vs. NCBI nr
Match: KAG6592144.1 (Cysteine proteinase inhibitor 1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 157.1 bits (396), Expect = 9.0e-35 Identity = 76/117 (64.96%), Postives = 92/117 (78.63%), Query Frame = 0
BLAST of Moc11g13190 vs. NCBI nr
Match: XP_022975710.1 (cysteine proteinase inhibitor 1-like [Cucurbita maxima]) HSP 1 Score: 156.8 bits (395), Expect = 1.2e-34 Identity = 75/117 (64.10%), Postives = 91/117 (77.78%), Query Frame = 0
BLAST of Moc11g13190 vs. NCBI nr
Match: KAG6592148.1 (Cysteine proteinase inhibitor 1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 156.8 bits (395), Expect = 1.2e-34 Identity = 76/117 (64.96%), Postives = 91/117 (77.78%), Query Frame = 0
BLAST of Moc11g13190 vs. NCBI nr
Match: XP_022936213.1 (cysteine proteinase inhibitor 1-like [Cucurbita moschata]) HSP 1 Score: 155.2 bits (391), Expect = 3.4e-34 Identity = 75/117 (64.10%), Postives = 90/117 (76.92%), Query Frame = 0
BLAST of Moc11g13190 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 100.1 bits (248), Expect = 1.7e-20 Identity = 49/98 (50.00%), Postives = 68/98 (69.39%), Query Frame = 0
BLAST of Moc11g13190 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 1.1e-19 Identity = 46/86 (53.49%), Postives = 64/86 (74.42%), Query Frame = 0
BLAST of Moc11g13190 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 89.0 bits (219), Expect = 3.9e-17 Identity = 47/89 (52.81%), Postives = 59/89 (66.29%), Query Frame = 0
BLAST of Moc11g13190 vs. ExPASy Swiss-Prot
Match: Q10J94 (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 9.1e-14 Identity = 38/90 (42.22%), Postives = 60/90 (66.67%), Query Frame = 0
BLAST of Moc11g13190 vs. ExPASy Swiss-Prot
Match: Q84WT8 (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana OX=3702 GN=CYS4 PE=3 SV=2) HSP 1 Score: 72.8 bits (177), Expect = 2.9e-12 Identity = 39/87 (44.83%), Postives = 56/87 (64.37%), Query Frame = 0
BLAST of Moc11g13190 vs. ExPASy TrEMBL
Match: A0A6J1DHK4 (cysteine proteinase inhibitor 1-like OS=Momordica charantia OX=3673 GN=LOC111021157 PE=4 SV=1) HSP 1 Score: 248.4 bits (633), Expect = 1.4e-62 Identity = 117/117 (100.00%), Postives = 117/117 (100.00%), Query Frame = 0
BLAST of Moc11g13190 vs. ExPASy TrEMBL
Match: A0A6J1IHH5 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111475753 PE=4 SV=1) HSP 1 Score: 156.8 bits (395), Expect = 5.7e-35 Identity = 75/117 (64.10%), Postives = 91/117 (77.78%), Query Frame = 0
BLAST of Moc11g13190 vs. ExPASy TrEMBL
Match: A0A6J1FCN1 (cysteine proteinase inhibitor 1-like OS=Cucurbita moschata OX=3662 GN=LOC111442885 PE=4 SV=1) HSP 1 Score: 155.2 bits (391), Expect = 1.7e-34 Identity = 75/117 (64.10%), Postives = 90/117 (76.92%), Query Frame = 0
BLAST of Moc11g13190 vs. ExPASy TrEMBL
Match: A0A6J1F7N7 (cysteine proteinase inhibitor A-like OS=Cucurbita moschata OX=3662 GN=LOC111442883 PE=4 SV=1) HSP 1 Score: 134.0 bits (336), Expect = 3.9e-28 Identity = 69/117 (58.97%), Postives = 82/117 (70.09%), Query Frame = 0
BLAST of Moc11g13190 vs. ExPASy TrEMBL
Match: A0A6J1IK23 (cysteine proteinase inhibitor A-like OS=Cucurbita maxima OX=3661 GN=LOC111475738 PE=4 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 2.6e-27 Identity = 68/117 (58.12%), Postives = 81/117 (69.23%), Query Frame = 0
BLAST of Moc11g13190 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 89.0 bits (219), Expect = 2.8e-18 Identity = 47/89 (52.81%), Postives = 59/89 (66.29%), Query Frame = 0
BLAST of Moc11g13190 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 72.8 bits (177), Expect = 2.1e-13 Identity = 39/87 (44.83%), Postives = 56/87 (64.37%), Query Frame = 0
BLAST of Moc11g13190 vs. TAIR 10
Match: AT2G40880.1 (cystatin A ) HSP 1 Score: 66.2 bits (160), Expect = 1.9e-11 Identity = 33/79 (41.77%), Postives = 45/79 (56.96%), Query Frame = 0
BLAST of Moc11g13190 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 63.9 bits (154), Expect = 9.6e-11 Identity = 38/90 (42.22%), Postives = 50/90 (55.56%), Query Frame = 0
BLAST of Moc11g13190 vs. TAIR 10
Match: AT3G12490.1 (cystatin B ) HSP 1 Score: 63.9 bits (154), Expect = 9.6e-11 Identity = 38/90 (42.22%), Postives = 50/90 (55.56%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (OHB3-1) v2
Date Performed: 2022-08-01 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|