
Moc11g13120 (gene) Bitter gourd (OHB3-1) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAGTTAACAAAACTTGGTCCATTGTTCATCTTCCACCTGGACAATATTCGATTGGGTGTAAGTGGGTCTATAAGGTGAAGCACAATTCCGATGGTTCGGTAGAGCACTACAAGGCTCGATTGGTTGCCAAGGGATATACACAACAAGAAGATGTTGATTTTATTGAAACCTTATCTCCAATTGCTAAATTGGTTGTTGTCAAGGTCCTTCTCACTATTGTTAAAATGCAAATGATTTGTATTAGTAATTTAATTATTATATTTTTTAAGAAAAATATGGGGATAACTAATATTGATTTAAATTACACTTTTTTTTCGGTCTCCCAATTTCGTGGTTCCATGGTAAGAAGTTCCCTTTTGCAAATTTTTAGGTGA ATGGAAGTTAACAAAACTTGGTCCATTGTTCATCTTCCACCTGGACAATATTCGATTGGGTGTAAGTGGGTCTATAAGGTGAAGCACAATTCCGATGGTTCGGTAGAGCACTACAAGGCTCGATTGGTTGCCAAGGGATATACACAACAAGAAGATGTTGATTTTATTGAAACCTTATCTCCAATTGCTAAATTGGTTGTTGTCAAGGTCCTTCTCACTATTGTTAAAATGCAAATGATTTGTATTAGTAATTTAATTATTATATTTTTTAAGAAAAATATGGGGATAACTAATATTGATTTAAATTACACTTTTTTTTCGGTCTCCCAATTTCGTGGTTCCATGGTAAGAAGTTCCCTTTTGCAAATTTTTAGGTGA ATGGAAGTTAACAAAACTTGGTCCATTGTTCATCTTCCACCTGGACAATATTCGATTGGGTGTAAGTGGGTCTATAAGGTGAAGCACAATTCCGATGGTTCGGTAGAGCACTACAAGGCTCGATTGGTTGCCAAGGGATATACACAACAAGAAGATGTTGATTTTATTGAAACCTTATCTCCAATTGCTAAATTGGTTGTTGTCAAGGTCCTTCTCACTATTGTTAAAATGCAAATGATTTGTATTAGTAATTTAATTATTATATTTTTTAAGAAAAATATGGGGATAACTAATATTGATTTAAATTACACTTTTTTTTCGGTCTCCCAATTTCGTGGTTCCATGGTAAGAAGTTCCCTTTTGCAAATTTTTAGGTGA MEVNKTWSIVHLPPGQYSIGCKWVYKVKHNSDGSVEHYKARLVAKGYTQQEDVDFIETLSPIAKLVVVKVLLTIVKMQMICISNLIIIFFKKNMGITNIDLNYTFFSVSQFRGSMVRSSLLQIFR Homology
BLAST of Moc11g13120 vs. NCBI nr
Match: XP_022154919.1 (uncharacterized protein LOC111022065 [Momordica charantia]) HSP 1 Score: 118.6 bits (296), Expect = 3.8e-23 Identity = 55/74 (74.32%), Postives = 63/74 (85.14%), Query Frame = 0
BLAST of Moc11g13120 vs. NCBI nr
Match: XP_022156273.1 (uncharacterized protein LOC111023206 [Momordica charantia]) HSP 1 Score: 118.2 bits (295), Expect = 4.9e-23 Identity = 55/74 (74.32%), Postives = 63/74 (85.14%), Query Frame = 0
BLAST of Moc11g13120 vs. NCBI nr
Match: XP_022147774.1 (uncharacterized protein LOC111016631 isoform X1 [Momordica charantia] >XP_022147776.1 uncharacterized protein LOC111016631 isoform X1 [Momordica charantia]) HSP 1 Score: 117.9 bits (294), Expect = 6.5e-23 Identity = 57/75 (76.00%), Postives = 65/75 (86.67%), Query Frame = 0
BLAST of Moc11g13120 vs. NCBI nr
Match: KAG7554761.1 (Retrotransposon gag domain [Arabidopsis suecica]) HSP 1 Score: 117.1 bits (292), Expect = 1.1e-22 Identity = 55/105 (52.38%), Postives = 72/105 (68.57%), Query Frame = 0
BLAST of Moc11g13120 vs. NCBI nr
Match: RVW99848.1 (Retrovirus-related Pol polyprotein from transposon RE1 [Vitis vinifera]) HSP 1 Score: 116.3 bits (290), Expect = 1.9e-22 Identity = 53/78 (67.95%), Postives = 65/78 (83.33%), Query Frame = 0
BLAST of Moc11g13120 vs. ExPASy Swiss-Prot
Match: Q94HW2 (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 9.7e-14 Identity = 34/72 (47.22%), Postives = 50/72 (69.44%), Query Frame = 0
BLAST of Moc11g13120 vs. ExPASy Swiss-Prot
Match: Q9ZT94 (Retrovirus-related Pol polyprotein from transposon RE2 OS=Arabidopsis thaliana OX=3702 GN=RE2 PE=4 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 3.7e-13 Identity = 34/72 (47.22%), Postives = 49/72 (68.06%), Query Frame = 0
BLAST of Moc11g13120 vs. ExPASy Swiss-Prot
Match: P92520 (Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana OX=3702 GN=AtMg00820 PE=4 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 8.2e-13 Identity = 40/95 (42.11%), Postives = 60/95 (63.16%), Query Frame = 0
BLAST of Moc11g13120 vs. ExPASy Swiss-Prot
Match: P10978 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 1.6e-11 Identity = 29/74 (39.19%), Postives = 50/74 (67.57%), Query Frame = 0
BLAST of Moc11g13120 vs. ExPASy Swiss-Prot
Match: P04146 (Copia protein OS=Drosophila melanogaster OX=7227 GN=GIP PE=1 SV=3) HSP 1 Score: 67.0 bits (162), Expect = 1.7e-10 Identity = 28/74 (37.84%), Postives = 50/74 (67.57%), Query Frame = 0
BLAST of Moc11g13120 vs. ExPASy TrEMBL
Match: A0A6J1DNP7 (uncharacterized protein LOC111022065 OS=Momordica charantia OX=3673 GN=LOC111022065 PE=4 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 1.8e-23 Identity = 55/74 (74.32%), Postives = 63/74 (85.14%), Query Frame = 0
BLAST of Moc11g13120 vs. ExPASy TrEMBL
Match: A0A6J1DQ66 (uncharacterized protein LOC111023206 OS=Momordica charantia OX=3673 GN=LOC111023206 PE=4 SV=1) HSP 1 Score: 118.2 bits (295), Expect = 2.4e-23 Identity = 55/74 (74.32%), Postives = 63/74 (85.14%), Query Frame = 0
BLAST of Moc11g13120 vs. ExPASy TrEMBL
Match: A0A6J1D203 (uncharacterized protein LOC111016631 isoform X1 OS=Momordica charantia OX=3673 GN=LOC111016631 PE=4 SV=1) HSP 1 Score: 117.9 bits (294), Expect = 3.1e-23 Identity = 57/75 (76.00%), Postives = 65/75 (86.67%), Query Frame = 0
BLAST of Moc11g13120 vs. ExPASy TrEMBL
Match: A5C102 (Integrase catalytic domain-containing protein OS=Vitis vinifera OX=29760 GN=VITISV_001913 PE=4 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 9.1e-23 Identity = 53/78 (67.95%), Postives = 65/78 (83.33%), Query Frame = 0
BLAST of Moc11g13120 vs. ExPASy TrEMBL
Match: A0A438CKS1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Vitis vinifera OX=29760 GN=POLX_3919 PE=4 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 9.1e-23 Identity = 53/78 (67.95%), Postives = 65/78 (83.33%), Query Frame = 0
BLAST of Moc11g13120 vs. TAIR 10
Match: AT4G23160.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 8 ) HSP 1 Score: 108.6 bits (270), Expect = 3.6e-24 Identity = 49/74 (66.22%), Postives = 58/74 (78.38%), Query Frame = 0
BLAST of Moc11g13120 vs. TAIR 10
Match: ATMG00820.1 (Reverse transcriptase (RNA-dependent DNA polymerase) ) HSP 1 Score: 74.7 bits (182), Expect = 5.8e-14 Identity = 40/95 (42.11%), Postives = 60/95 (63.16%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (OHB3-1) v2
Date Performed: 2022-08-01 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|