Moc11g05970 (gene) Bitter gourd (OHB3-1) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCAGGCGTTTGGGTTTTCCGATCGAACGGAGTGATGTGCCTCGTCGACAACGCCGCCGAGTTCTCCTCCGAAGCCAACCACGGCGGCGGCGGCGGCGGCCGGAATAAGAAGGTCCTCGTTCACCTTCCCTCCGGCCAGCCGGTTTCCTCCTATGGCTTCCTCCAGAAGATTCTCGAAGGCTTGGGCTGGGAGCGATACTACGAAGGCGATCCCGATTTCTTCCAATTCCACAAGCGATCCTCCATTGATCTCATTTCTCTTCCTATGGACTTCTCCAAATTCAACTCCATTTACATGTACGATCTCGTCATCAAAAACCCTAACGTCTTCCACGTTCGAGAATCCTAA ATGTCAGGCGTTTGGGTTTTCCGATCGAACGGAGTGATGTGCCTCGTCGACAACGCCGCCGAGTTCTCCTCCGAAGCCAACCACGGCGGCGGCGGCGGCGGCCGGAATAAGAAGGTCCTCGTTCACCTTCCCTCCGGCCAGCCGGTTTCCTCCTATGGCTTCCTCCAGAAGATTCTCGAAGGCTTGGGCTGGGAGCGATACTACGAAGGCGATCCCGATTTCTTCCAATTCCACAAGCGATCCTCCATTGATCTCATTTCTCTTCCTATGGACTTCTCCAAATTCAACTCCATTTACATGTACGATCTCGTCATCAAAAACCCTAACGTCTTCCACGTTCGAGAATCCTAA ATGTCAGGCGTTTGGGTTTTCCGATCGAACGGAGTGATGTGCCTCGTCGACAACGCCGCCGAGTTCTCCTCCGAAGCCAACCACGGCGGCGGCGGCGGCGGCCGGAATAAGAAGGTCCTCGTTCACCTTCCCTCCGGCCAGCCGGTTTCCTCCTATGGCTTCCTCCAGAAGATTCTCGAAGGCTTGGGCTGGGAGCGATACTACGAAGGCGATCCCGATTTCTTCCAATTCCACAAGCGATCCTCCATTGATCTCATTTCTCTTCCTATGGACTTCTCCAAATTCAACTCCATTTACATGTACGATCTCGTCATCAAAAACCCTAACGTCTTCCACGTTCGAGAATCCTAA MSGVWVFRSNGVMCLVDNAAEFSSEANHGGGGGGRNKKVLVHLPSGQPVSSYGFLQKILEGLGWERYYEGDPDFFQFHKRSSIDLISLPMDFSKFNSIYMYDLVIKNPNVFHVRES Homology
BLAST of Moc11g05970 vs. NCBI nr
Match: XP_022139436.1 (flowering-promoting factor 1-like protein 1 [Momordica charantia]) HSP 1 Score: 244.6 bits (623), Expect = 4.2e-61 Identity = 116/116 (100.00%), Postives = 116/116 (100.00%), Query Frame = 0
BLAST of Moc11g05970 vs. NCBI nr
Match: XP_008466327.1 (PREDICTED: flowering-promoting factor 1-like protein 2 [Cucumis melo] >KAA0052786.1 flowering-promoting factor 1-like protein 2 [Cucumis melo var. makuwa] >TYK08705.1 flowering-promoting factor 1-like protein 2 [Cucumis melo var. makuwa]) HSP 1 Score: 206.1 bits (523), Expect = 1.7e-49 Identity = 102/128 (79.69%), Postives = 109/128 (85.16%), Query Frame = 0
BLAST of Moc11g05970 vs. NCBI nr
Match: XP_022976219.1 (flowering-promoting factor 1-like protein 2 [Cucurbita maxima]) HSP 1 Score: 204.5 bits (519), Expect = 4.9e-49 Identity = 98/118 (83.05%), Postives = 106/118 (89.83%), Query Frame = 0
BLAST of Moc11g05970 vs. NCBI nr
Match: XP_004136318.1 (flowering-promoting factor 1-like protein 2 [Cucumis sativus] >KGN60157.1 hypothetical protein Csa_002053 [Cucumis sativus]) HSP 1 Score: 201.8 bits (512), Expect = 3.2e-48 Identity = 102/123 (82.93%), Postives = 109/123 (88.62%), Query Frame = 0
BLAST of Moc11g05970 vs. NCBI nr
Match: XP_022937028.1 (flowering-promoting factor 1-like protein 2 [Cucurbita moschata]) HSP 1 Score: 200.3 bits (508), Expect = 9.2e-48 Identity = 100/121 (82.64%), Postives = 108/121 (89.26%), Query Frame = 0
BLAST of Moc11g05970 vs. ExPASy Swiss-Prot
Match: Q5Q0B3 (Flowering-promoting factor 1-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=FLP1 PE=2 SV=2) HSP 1 Score: 152.5 bits (384), Expect = 2.9e-36 Identity = 79/123 (64.23%), Postives = 94/123 (76.42%), Query Frame = 0
BLAST of Moc11g05970 vs. ExPASy Swiss-Prot
Match: Q9LXB5 (Flowering-promoting factor 1-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=FLP2 PE=2 SV=1) HSP 1 Score: 142.5 bits (358), Expect = 3.0e-33 Identity = 69/115 (60.00%), Postives = 86/115 (74.78%), Query Frame = 0
BLAST of Moc11g05970 vs. ExPASy Swiss-Prot
Match: O23624 (Flowering-promoting factor 1 OS=Arabidopsis thaliana OX=3702 GN=FPF1 PE=1 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 6.6e-33 Identity = 71/117 (60.68%), Postives = 88/117 (75.21%), Query Frame = 0
BLAST of Moc11g05970 vs. ExPASy Swiss-Prot
Match: O24340 (Flowering-promoting factor 1 OS=Sinapis alba OX=3728 GN=FPF1 PE=2 SV=1) HSP 1 Score: 141.0 bits (354), Expect = 8.7e-33 Identity = 70/117 (59.83%), Postives = 88/117 (75.21%), Query Frame = 0
BLAST of Moc11g05970 vs. ExPASy Swiss-Prot
Match: Q8LR63 (Flowering-promoting factor 1-like protein 2 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0933500 PE=2 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 1.1e-27 Identity = 64/125 (51.20%), Postives = 83/125 (66.40%), Query Frame = 0
BLAST of Moc11g05970 vs. ExPASy TrEMBL
Match: A0A6J1CCN4 (flowering-promoting factor 1-like protein 1 OS=Momordica charantia OX=3673 GN=LOC111010367 PE=3 SV=1) HSP 1 Score: 244.6 bits (623), Expect = 2.1e-61 Identity = 116/116 (100.00%), Postives = 116/116 (100.00%), Query Frame = 0
BLAST of Moc11g05970 vs. ExPASy TrEMBL
Match: A0A5A7UF14 (Flowering-promoting factor 1-like protein 2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold64983G00010 PE=3 SV=1) HSP 1 Score: 206.1 bits (523), Expect = 8.1e-50 Identity = 102/128 (79.69%), Postives = 109/128 (85.16%), Query Frame = 0
BLAST of Moc11g05970 vs. ExPASy TrEMBL
Match: A0A1S3CSB1 (flowering-promoting factor 1-like protein 2 OS=Cucumis melo OX=3656 GN=LOC103503767 PE=3 SV=1) HSP 1 Score: 206.1 bits (523), Expect = 8.1e-50 Identity = 102/128 (79.69%), Postives = 109/128 (85.16%), Query Frame = 0
BLAST of Moc11g05970 vs. ExPASy TrEMBL
Match: A0A6J1IMX4 (flowering-promoting factor 1-like protein 2 OS=Cucurbita maxima OX=3661 GN=LOC111476674 PE=3 SV=1) HSP 1 Score: 204.5 bits (519), Expect = 2.4e-49 Identity = 98/118 (83.05%), Postives = 106/118 (89.83%), Query Frame = 0
BLAST of Moc11g05970 vs. ExPASy TrEMBL
Match: A0A0A0LHE6 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G881700 PE=3 SV=1) HSP 1 Score: 201.8 bits (512), Expect = 1.5e-48 Identity = 102/123 (82.93%), Postives = 109/123 (88.62%), Query Frame = 0
BLAST of Moc11g05970 vs. TAIR 10
Match: AT4G31380.1 (FPF1-like protein 1 ) HSP 1 Score: 152.5 bits (384), Expect = 2.0e-37 Identity = 79/123 (64.23%), Postives = 94/123 (76.42%), Query Frame = 0
BLAST of Moc11g05970 vs. TAIR 10
Match: AT5G10625.1 (BEST Arabidopsis thaliana protein match is: flowering promoting factor 1 (TAIR:AT5G24860.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). ) HSP 1 Score: 142.5 bits (358), Expect = 2.1e-34 Identity = 69/115 (60.00%), Postives = 86/115 (74.78%), Query Frame = 0
BLAST of Moc11g05970 vs. TAIR 10
Match: AT5G24860.1 (flowering promoting factor 1 ) HSP 1 Score: 141.4 bits (355), Expect = 4.7e-34 Identity = 71/117 (60.68%), Postives = 88/117 (75.21%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (OHB3-1) v2
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|