Moc10g12640 (gene) Bitter gourd (OHB3-1) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATGACAAATTGCGAAGAAAATGGTTGATACGGAAACTTCGTCCCAAGGACAAGGTTATTTTAGGTTCTTTTCATCAATTGCTTCCATTATATTATTTCTGTTTCTGCTTTTCTTGTGTTTGCAAAGAAAAAATTAATGTTTCTTTTTCAACAGATGAAGATTTGTTTGAGAGTGGCCATAAACAAGGTAGTTGTTCTATGGGTTTGGAGATTGTATATGATCGCGGATTTGAAGGCTAAAATTGCAGCAGAAGAAGGTATTCCCATTCAACAAAAAGTCTTGAATTTCCAAGGACGTAGGCTTGAAGATAGCGAAACTCTAGCAGACTATGGCATCAGAAGCGATAATGTTGTGTGCATGTTTTAG ATGAATGACAAATTGCGAAGAAAATGGTTGATACGGAAACTTCGTCCCAAGGACAAGATGAAGATTTGTTTGAGAGTGGCCATAAACAAGGTAGTTGTTCTATGGGTTTGGAGATTGTATATGATCGCGGATTTGAAGGCTAAAATTGCAGCAGAAGAAGGTATTCCCATTCAACAAAAAGTCTTGAATTTCCAAGGACGTAGGCTTGAAGATAGCGAAACTCTAGCAGACTATGGCATCAGAAGCGATAATGTTGTGTGCATGTTTTAG ATGAATGACAAATTGCGAAGAAAATGGTTGATACGGAAACTTCGTCCCAAGGACAAGATGAAGATTTGTTTGAGAGTGGCCATAAACAAGGTAGTTGTTCTATGGGTTTGGAGATTGTATATGATCGCGGATTTGAAGGCTAAAATTGCAGCAGAAGAAGGTATTCCCATTCAACAAAAAGTCTTGAATTTCCAAGGACGTAGGCTTGAAGATAGCGAAACTCTAGCAGACTATGGCATCAGAAGCGATAATGTTGTGTGCATGTTTTAG MNDKLRRKWLIRKLRPKDKMKICLRVAINKVVVLWVWRLYMIADLKAKIAAEEGIPIQQKVLNFQGRRLEDSETLADYGIRSDNVVCMF Homology
BLAST of Moc10g12640 vs. NCBI nr
Match: XP_008463442.1 (PREDICTED: polyubiquitin-like [Cucumis melo] >KAA0025478.1 polyubiquitin-like [Cucumis melo var. makuwa] >TYK00387.1 polyubiquitin-like [Cucumis melo var. makuwa]) HSP 1 Score: 65.9 bits (159), Expect = 2.1e-07 Identity = 38/82 (46.34%), Postives = 53/82 (64.63%), Query Frame = 0
BLAST of Moc10g12640 vs. NCBI nr
Match: KAG2582037.1 (hypothetical protein PVAP13_6KG092800 [Panicum virgatum]) HSP 1 Score: 61.2 bits (147), Expect = 5.1e-06 Identity = 32/72 (44.44%), Postives = 46/72 (63.89%), Query Frame = 0
BLAST of Moc10g12640 vs. NCBI nr
Match: XP_022154970.1 (ubiquitin-like isoform X1 [Momordica charantia] >XP_022154971.1 ubiquitin-like isoform X1 [Momordica charantia]) HSP 1 Score: 60.1 bits (144), Expect = 1.1e-05 Identity = 34/88 (38.64%), Postives = 53/88 (60.23%), Query Frame = 0
BLAST of Moc10g12640 vs. NCBI nr
Match: CAD6225216.1 (unnamed protein product [Miscanthus lutarioriparius]) HSP 1 Score: 58.5 bits (140), Expect = 3.3e-05 Identity = 31/70 (44.29%), Postives = 46/70 (65.71%), Query Frame = 0
BLAST of Moc10g12640 vs. NCBI nr
Match: CAE8715441.1 (unnamed protein product, partial [Polarella glacialis]) HSP 1 Score: 57.8 bits (138), Expect = 5.6e-05 Identity = 29/71 (40.85%), Postives = 45/71 (63.38%), Query Frame = 0
BLAST of Moc10g12640 vs. ExPASy Swiss-Prot
Match: P16709 (viral Ubiquitin OS=Autographa californica nuclear polyhedrosis virus OX=46015 GN=vUbi PE=1 SV=2) HSP 1 Score: 56.2 bits (134), Expect = 2.2e-07 Identity = 27/69 (39.13%), Postives = 44/69 (63.77%), Query Frame = 0
BLAST of Moc10g12640 vs. ExPASy Swiss-Prot
Match: P0CG71 (Polyubiquitin-A OS=Caenorhabditis elegans OX=6239 GN=ubq-1 PE=3 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 2.4e-06 Identity = 29/73 (39.73%), Postives = 45/73 (61.64%), Query Frame = 0
BLAST of Moc10g12640 vs. ExPASy Swiss-Prot
Match: P69315 (Polyubiquitin (Fragment) OS=Linum usitatissimum OX=4006 PE=3 SV=2) HSP 1 Score: 52.8 bits (125), Expect = 2.4e-06 Identity = 30/73 (41.10%), Postives = 44/73 (60.27%), Query Frame = 0
BLAST of Moc10g12640 vs. ExPASy Swiss-Prot
Match: Q3E7K8 (Polyubiquitin 12 OS=Arabidopsis thaliana OX=3702 GN=UBQ12 PE=3 SV=1) HSP 1 Score: 52.4 bits (124), Expect = 3.1e-06 Identity = 30/73 (41.10%), Postives = 44/73 (60.27%), Query Frame = 0
BLAST of Moc10g12640 vs. ExPASy Swiss-Prot
Match: P0CH27 (Ubiquitin-60S ribosomal protein L40 OS=Trypanosoma cruzi OX=5693 PE=2 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 4.1e-06 Identity = 29/73 (39.73%), Postives = 44/73 (60.27%), Query Frame = 0
BLAST of Moc10g12640 vs. ExPASy TrEMBL
Match: A0A5D3BMH5 (Polyubiquitin-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1112G00560 PE=4 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 1.0e-07 Identity = 38/82 (46.34%), Postives = 53/82 (64.63%), Query Frame = 0
BLAST of Moc10g12640 vs. ExPASy TrEMBL
Match: A0A1S3CKU5 (polyubiquitin-like OS=Cucumis melo OX=3656 GN=LOC103501609 PE=4 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 1.0e-07 Identity = 38/82 (46.34%), Postives = 53/82 (64.63%), Query Frame = 0
BLAST of Moc10g12640 vs. ExPASy TrEMBL
Match: A0A6J1DL46 (ubiquitin-like isoform X1 OS=Momordica charantia OX=3673 GN=LOC111022115 PE=4 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 5.5e-06 Identity = 34/88 (38.64%), Postives = 53/88 (60.23%), Query Frame = 0
BLAST of Moc10g12640 vs. ExPASy TrEMBL
Match: A0A0D2VG82 (Uncharacterized protein OS=Gossypium raimondii OX=29730 GN=B456_013G163500 PE=4 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 6.1e-05 Identity = 31/74 (41.89%), Postives = 45/74 (60.81%), Query Frame = 0
BLAST of Moc10g12640 vs. ExPASy TrEMBL
Match: S5G9A4 (Ac-v-ubi OS=Autographa californica nuclear polyhedrosis virus OX=46015 GN=Ac-v-ubi PE=4 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 8.0e-05 Identity = 27/69 (39.13%), Postives = 44/69 (63.77%), Query Frame = 0
BLAST of Moc10g12640 vs. TAIR 10
Match: AT1G53930.1 (Ubiquitin-like superfamily protein ) HSP 1 Score: 53.5 bits (127), Expect = 9.9e-08 Identity = 27/67 (40.30%), Postives = 45/67 (67.16%), Query Frame = 0
BLAST of Moc10g12640 vs. TAIR 10
Match: AT1G55060.1 (ubiquitin 12 ) HSP 1 Score: 52.4 bits (124), Expect = 2.2e-07 Identity = 30/73 (41.10%), Postives = 44/73 (60.27%), Query Frame = 0
BLAST of Moc10g12640 vs. TAIR 10
Match: AT4G05320.2 (polyubiquitin 10 ) HSP 1 Score: 51.6 bits (122), Expect = 3.8e-07 Identity = 29/73 (39.73%), Postives = 44/73 (60.27%), Query Frame = 0
BLAST of Moc10g12640 vs. TAIR 10
Match: AT4G02890.1 (Ubiquitin family protein ) HSP 1 Score: 51.6 bits (122), Expect = 3.8e-07 Identity = 29/73 (39.73%), Postives = 44/73 (60.27%), Query Frame = 0
BLAST of Moc10g12640 vs. TAIR 10
Match: AT4G05050.1 (ubiquitin 11 ) HSP 1 Score: 51.6 bits (122), Expect = 3.8e-07 Identity = 29/73 (39.73%), Postives = 44/73 (60.27%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (OHB3-1) v2
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|