
MS022136 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.AGTAGGGGTTGCAAACCAGACGGTACACAACTTGGTTTTGGAAGATATGGCACTAAAAGTTGTAGAGCTGGTCGTCTTTCATATCGAGCCATTGAAGCAGCGCGTCGGGCTATAATCGGACAATTCCGAAGAAATGGTAAAATATGGGTAAGAGTTCTCGCGGATCTCCCTATTACCGGGAAACCTACAGAAGTCAGAATGGGAAGAGGAAAAGGAAATCCTACGGGTTGGATTGCTCATGTGTCCACGGGA AGTAGGGGTTGCAAACCAGACGGTACACAACTTGGTTTTGGAAGATATGGCACTAAAAGTTGTAGAGCTGGTCGTCTTTCATATCGAGCCATTGAAGCAGCGCGTCGGGCTATAATCGGACAATTCCGAAGAAATGGTAAAATATGGGTAAGAGTTCTCGCGGATCTCCCTATTACCGGGAAACCTACAGAAGTCAGAATGGGAAGAGGAAAAGGAAATCCTACGGGTTGGATTGCTCATGTGTCCACGGGA AGTAGGGGTTGCAAACCAGACGGTACACAACTTGGTTTTGGAAGATATGGCACTAAAAGTTGTAGAGCTGGTCGTCTTTCATATCGAGCCATTGAAGCAGCGCGTCGGGCTATAATCGGACAATTCCGAAGAAATGGTAAAATATGGGTAAGAGTTCTCGCGGATCTCCCTATTACCGGGAAACCTACAGAAGTCAGAATGGGAAGAGGAAAAGGAAATCCTACGGGTTGGATTGCTCATGTGTCCACGGGA SRGCKPDGTQLGFGRYGTKSCRAGRLSYRAIEAARRAIIGQFRRNGKIWVRVLADLPITGKPTEVRMGRGKGNPTGWIAHVSTG Homology
BLAST of MS022136 vs. NCBI nr
Match: KAG6736870.1 (hypothetical protein POTOM_060208 [Populus tomentosa]) HSP 1 Score: 173.3 bits (438), Expect = 8.7e-40 Identity = 81/84 (96.43%), Postives = 83/84 (98.81%), Query Frame = 0
BLAST of MS022136 vs. NCBI nr
Match: YP_009745364.1 (ribosomal protein L16 [Salix paraflabellaris] >YP_009988226.1 ribosomal protein L16 [Salix cardiophylla] >YP_009988263.1 ribosomal protein L16 [Salix polaris] >QIH29810.1 ribosomal protein L16 [Salix paraflabellaris] >QNM38472.1 ribosomal protein L16 [Salix cardiophylla] >QNM38509.1 ribosomal protein L16 [Salix polaris]) HSP 1 Score: 173.3 bits (438), Expect = 8.7e-40 Identity = 81/84 (96.43%), Postives = 83/84 (98.81%), Query Frame = 0
BLAST of MS022136 vs. NCBI nr
Match: YP_009230369.1 (ribosomal protein L16, partial [Salix suchowensis] >AMF83889.1 ribosomal protein L16, partial [Salix suchowensis]) HSP 1 Score: 173.3 bits (438), Expect = 8.7e-40 Identity = 81/84 (96.43%), Postives = 83/84 (98.81%), Query Frame = 0
BLAST of MS022136 vs. NCBI nr
Match: KAG6746851.1 (hypothetical protein POTOM_049222 [Populus tomentosa]) HSP 1 Score: 173.3 bits (438), Expect = 8.7e-40 Identity = 81/84 (96.43%), Postives = 83/84 (98.81%), Query Frame = 0
BLAST of MS022136 vs. NCBI nr
Match: KAF9660759.1 (hypothetical protein SADUNF_SadunfMtG0007400 [Salix dunnii]) HSP 1 Score: 173.3 bits (438), Expect = 8.7e-40 Identity = 81/84 (96.43%), Postives = 83/84 (98.81%), Query Frame = 0
BLAST of MS022136 vs. ExPASy Swiss-Prot
Match: Q04715 (60S ribosomal protein L16, mitochondrial OS=Petunia hybrida OX=4102 GN=RPL16 PE=2 SV=1) HSP 1 Score: 164.5 bits (415), Expect = 5.3e-40 Identity = 81/92 (88.04%), Postives = 82/92 (89.13%), Query Frame = 0
BLAST of MS022136 vs. ExPASy Swiss-Prot
Match: P46801 (60S ribosomal protein L16, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=RPL16 PE=3 SV=1) HSP 1 Score: 158.7 bits (400), Expect = 2.9e-38 Identity = 79/92 (85.87%), Postives = 80/92 (86.96%), Query Frame = 0
BLAST of MS022136 vs. ExPASy Swiss-Prot
Match: P49389 (60S ribosomal protein L16, mitochondrial OS=Brassica napus OX=3708 GN=RPL16 PE=3 SV=2) HSP 1 Score: 158.3 bits (399), Expect = 3.8e-38 Identity = 79/93 (84.95%), Postives = 80/93 (86.02%), Query Frame = 0
BLAST of MS022136 vs. ExPASy Swiss-Prot
Match: Q95747 (60S ribosomal protein L16, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RPL16 PE=1 SV=3) HSP 1 Score: 157.9 bits (398), Expect = 5.0e-38 Identity = 78/92 (84.78%), Postives = 80/92 (86.96%), Query Frame = 0
BLAST of MS022136 vs. ExPASy Swiss-Prot
Match: P27927 (60S ribosomal protein L16, mitochondrial OS=Zea mays OX=4577 GN=RPL16 PE=3 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 1.0e-35 Identity = 77/92 (83.70%), Postives = 78/92 (84.78%), Query Frame = 0
BLAST of MS022136 vs. ExPASy TrEMBL
Match: A0A6N2KSZ4 (Ribosomal_L16 domain-containing protein OS=Salix viminalis OX=40686 GN=SVIM_LOCUS127822 PE=3 SV=1) HSP 1 Score: 173.3 bits (438), Expect = 4.2e-40 Identity = 81/84 (96.43%), Postives = 83/84 (98.81%), Query Frame = 0
BLAST of MS022136 vs. ExPASy TrEMBL
Match: A0A7G9ISX8 (Ribosomal protein L16 OS=Salix cardiophylla OX=688335 GN=rpl16 PE=3 SV=1) HSP 1 Score: 173.3 bits (438), Expect = 4.2e-40 Identity = 81/84 (96.43%), Postives = 83/84 (98.81%), Query Frame = 0
BLAST of MS022136 vs. ExPASy TrEMBL
Match: A0A109WWC5 (Ribosomal protein L16 (Fragment) OS=Salix suchowensis OX=1278906 GN=rpl16 PE=3 SV=1) HSP 1 Score: 173.3 bits (438), Expect = 4.2e-40 Identity = 81/84 (96.43%), Postives = 83/84 (98.81%), Query Frame = 0
BLAST of MS022136 vs. ExPASy TrEMBL
Match: A0A451FPI4 (Ribosomal protein L16 (Fragment) OS=Populus alba OX=43335 GN=rpl16 PE=3 SV=1) HSP 1 Score: 173.3 bits (438), Expect = 4.2e-40 Identity = 81/84 (96.43%), Postives = 83/84 (98.81%), Query Frame = 0
BLAST of MS022136 vs. ExPASy TrEMBL
Match: A0A140HPA9 (Ribosomal protein L16 OS=Salix purpurea OX=77065 GN=rpl16 PE=3 SV=1) HSP 1 Score: 173.3 bits (438), Expect = 4.2e-40 Identity = 81/84 (96.43%), Postives = 83/84 (98.81%), Query Frame = 0
BLAST of MS022136 vs. TAIR 10
Match: ATMG00080.1 (ribosomal protein L16 ) HSP 1 Score: 163.3 bits (412), Expect = 8.4e-41 Identity = 80/92 (86.96%), Postives = 82/92 (89.13%), Query Frame = 0
BLAST of MS022136 vs. TAIR 10
Match: ATCG00790.1 (ribosomal protein L16 ) HSP 1 Score: 80.1 bits (196), Expect = 9.3e-16 Identity = 37/83 (44.58%), Postives = 50/83 (60.24%), Query Frame = 0
BLAST of MS022136 vs. TAIR 10
Match: AT2G28830.1 (PLANT U-BOX 12 ) HSP 1 Score: 58.5 bits (140), Expect = 2.9e-09 Identity = 29/70 (41.43%), Postives = 39/70 (55.71%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|