MS022066 (gene) Bitter gourd (TR) v1
|
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.GACCCTCTCCAGTACGGGAAGATCGGAAGATATTATGCACAGCTTAGAGTATGTTGATTTTAGATCCCGAGACCGGAGAGTACAGTGCAGAGAAAACACCGAGTTATGGGAAGGACAAATTGGAAGACTTCTTTGAAAGGGTCCTCGGGGAAGGGATGGCTGGTCAAGAATTAGGCGAACAGACGGACCCTCTCCAGTACGGGAAGATCGGAAGATATTATGCACAGAGTATGTTGATTTTAGATCCCGAGACCGGAGAGTACAGTGCAGAGAAAACACCGAGTTATGGGAAGGACAAATTGGAAGACTTCTTTGAAAGGGTCCTCGGGGAAGGGATGGCTGGTCAAGAATTAGGCGAACAGACG GACCCTCTCCAGTACGGGAAGATCGGAAGATATTATGCACAGAGTATGTTGATTTTAGATCCCGAGACCGGAGAGTACAGTGCAGAGAAAACACCGAGTTATGGGAAGGACAAATTGGAAGACTTCTTTGAAAGGGTCCTCGGGGAAGGGATGGCTGGTCAAGAATTAGGCGAACAGACG DPLQYGKIGRYYAQSMLILDPETGEYSAEKTPSYGKDKLEDFFERVLGEGMAGQELGEQT Homology
BLAST of MS022066 vs. NCBI nr
Match: XP_038877599.1 (divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic [Benincasa hispida]) HSP 1 Score: 109.0 bits (271), Expect = 1.4e-20 Identity = 53/61 (86.89%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of MS022066 vs. NCBI nr
Match: KAG6597493.1 (Divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 108.2 bits (269), Expect = 2.5e-20 Identity = 53/61 (86.89%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of MS022066 vs. NCBI nr
Match: KAG7028953.1 (Divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 108.2 bits (269), Expect = 2.5e-20 Identity = 53/61 (86.89%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of MS022066 vs. NCBI nr
Match: XP_023528868.1 (divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic [Cucurbita pepo subsp. pepo] >XP_023528869.1 divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic [Cucurbita pepo subsp. pepo]) HSP 1 Score: 107.8 bits (268), Expect = 3.2e-20 Identity = 53/61 (86.89%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of MS022066 vs. NCBI nr
Match: KAG6582241.1 (Divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 107.8 bits (268), Expect = 3.2e-20 Identity = 53/61 (86.89%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of MS022066 vs. ExPASy Swiss-Prot
Match: J9RYI6 (Divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic OS=Cucumis sativus OX=3659 GN=DVR PE=1 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 4.2e-23 Identity = 52/61 (85.25%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of MS022066 vs. ExPASy Swiss-Prot
Match: B6SZW0 (Divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic OS=Zea mays OX=4577 GN=DVR PE=1 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 5.1e-21 Identity = 48/61 (78.69%), Postives = 54/61 (88.52%), Query Frame = 0
BLAST of MS022066 vs. ExPASy Swiss-Prot
Match: Q1H537 (Divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DVR PE=1 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 4.4e-20 Identity = 47/57 (82.46%), Postives = 52/57 (91.23%), Query Frame = 0
BLAST of MS022066 vs. ExPASy Swiss-Prot
Match: D5L1S4 (Divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic OS=Oryza sativa subsp. indica OX=39946 GN=DVR PE=1 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 7.4e-20 Identity = 46/61 (75.41%), Postives = 52/61 (85.25%), Query Frame = 0
BLAST of MS022066 vs. ExPASy Swiss-Prot
Match: Q10LH0 (Divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=DVR PE=3 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 7.4e-20 Identity = 46/61 (75.41%), Postives = 52/61 (85.25%), Query Frame = 0
BLAST of MS022066 vs. ExPASy TrEMBL
Match: A0A6J1IUD4 (Divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic OS=Cucurbita maxima OX=3661 GN=LOC111479393 PE=4 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 1.6e-20 Identity = 53/61 (86.89%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of MS022066 vs. ExPASy TrEMBL
Match: A0A6J1GW37 (Divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic OS=Cucurbita moschata OX=3662 GN=LOC111458024 PE=4 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 1.6e-20 Identity = 53/61 (86.89%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of MS022066 vs. ExPASy TrEMBL
Match: A0A0A0L5R4 (Divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic OS=Cucumis sativus OX=3659 GN=Csa_3G151460 PE=4 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 1.6e-20 Identity = 52/61 (85.25%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of MS022066 vs. ExPASy TrEMBL
Match: A0A2P5E3Z7 (Divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic OS=Parasponia andersonii OX=3476 GN=PanWU01x14_007170 PE=4 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 3.5e-20 Identity = 52/61 (85.25%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of MS022066 vs. ExPASy TrEMBL
Match: A0A6J1C850 (Divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic OS=Momordica charantia OX=3673 GN=LOC111009253 PE=4 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 3.5e-20 Identity = 53/61 (86.89%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of MS022066 vs. TAIR 10
Match: AT5G18660.1 (NAD(P)-binding Rossmann-fold superfamily protein ) HSP 1 Score: 97.8 bits (242), Expect = 3.1e-21 Identity = 47/57 (82.46%), Postives = 52/57 (91.23%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|