
MS020398 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TTGGGAAGTGGTTGGAAGAGATTTGCTCGAGACAATAGCTTGCAAGTCGGCGATGTCTGCGTTTTTGAGATGATGAGAAAGAACAGTAGAAGAATCTCGCTCAAAGTTTACATTTTTCAA TTGGGAAGTGGTTGGAAGAGATTTGCTCGAGACAATAGCTTGCAAGTCGGCGATGTCTGCGTTTTTGAGATGATGAGAAAGAACAGTAGAAGAATCTCGCTCAAAGTTTACATTTTTCAA TTGGGAAGTGGTTGGAAGAGATTTGCTCGAGACAATAGCTTGCAAGTCGGCGATGTCTGCGTTTTTGAGATGATGAGAAAGAACAGTAGAAGAATCTCGCTCAAAGTTTACATTTTTCAA LGSGWKRFARDNSLQVGDVCVFEMMRKNSRRISLKVYIFQ Homology
BLAST of MS020398 vs. NCBI nr
Match: XP_022158239.1 (B3 domain-containing transcription factor VRN1-like [Momordica charantia]) HSP 1 Score: 85.5 bits (210), Expect = 1.1e-13 Identity = 40/40 (100.00%), Postives = 40/40 (100.00%), Query Frame = 0
BLAST of MS020398 vs. NCBI nr
Match: XP_038900379.1 (B3 domain-containing transcription factor VRN1-like [Benincasa hispida]) HSP 1 Score: 58.9 bits (141), Expect = 1.1e-05 Identity = 26/37 (70.27%), Postives = 30/37 (81.08%), Query Frame = 0
BLAST of MS020398 vs. NCBI nr
Match: XP_016902162.1 (PREDICTED: B3 domain-containing protein At3g18960-like [Cucumis melo]) HSP 1 Score: 55.8 bits (133), Expect = 9.6e-05 Identity = 24/40 (60.00%), Postives = 32/40 (80.00%), Query Frame = 0
BLAST of MS020398 vs. NCBI nr
Match: XP_024021327.1 (B3 domain-containing transcription factor VRN1 [Morus notabilis]) HSP 1 Score: 55.5 bits (132), Expect = 1.3e-04 Identity = 21/40 (52.50%), Postives = 32/40 (80.00%), Query Frame = 0
BLAST of MS020398 vs. NCBI nr
Match: CAD6205877.1 (unnamed protein product [Miscanthus lutarioriparius]) HSP 1 Score: 55.5 bits (132), Expect = 1.3e-04 Identity = 22/38 (57.89%), Postives = 32/38 (84.21%), Query Frame = 0
BLAST of MS020398 vs. ExPASy Swiss-Prot
Match: Q8RYD1 (B3 domain-containing protein REM16 OS=Arabidopsis thaliana OX=3702 GN=REM16 PE=2 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 9.1e-06 Identity = 19/40 (47.50%), Postives = 29/40 (72.50%), Query Frame = 0
BLAST of MS020398 vs. ExPASy Swiss-Prot
Match: Q851V5 (Putative B3 domain-containing protein Os03g0621600 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0621600 PE=3 SV=1) HSP 1 Score: 47.8 bits (112), Expect = 3.4e-05 Identity = 16/36 (44.44%), Postives = 29/36 (80.56%), Query Frame = 0
BLAST of MS020398 vs. ExPASy Swiss-Prot
Match: Q2QMT6 (B3 domain-containing protein LOC_Os12g40080 OS=Oryza sativa subsp. japonica OX=39947 GN=Os12g0591400 PE=3 SV=1) HSP 1 Score: 45.1 bits (105), Expect = 2.2e-04 Identity = 16/40 (40.00%), Postives = 30/40 (75.00%), Query Frame = 0
BLAST of MS020398 vs. ExPASy Swiss-Prot
Match: Q851W4 (B3 domain-containing protein Os03g0620500 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0620500 PE=2 SV=1) HSP 1 Score: 43.9 bits (102), Expect = 5.0e-04 Identity = 15/37 (40.54%), Postives = 27/37 (72.97%), Query Frame = 0
BLAST of MS020398 vs. ExPASy Swiss-Prot
Match: Q6AV21 (B3 domain-containing protein Os03g0619800 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0619800 PE=3 SV=1) HSP 1 Score: 43.9 bits (102), Expect = 5.0e-04 Identity = 17/38 (44.74%), Postives = 31/38 (81.58%), Query Frame = 0
BLAST of MS020398 vs. ExPASy TrEMBL
Match: A0A6J1DYT9 (B3 domain-containing transcription factor VRN1-like OS=Momordica charantia OX=3673 GN=LOC111024772 PE=4 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 5.5e-14 Identity = 40/40 (100.00%), Postives = 40/40 (100.00%), Query Frame = 0
BLAST of MS020398 vs. ExPASy TrEMBL
Match: A0A1S4E1R1 (B3 domain-containing protein At3g18960-like OS=Cucumis melo OX=3656 GN=LOC103497525 PE=4 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 4.7e-05 Identity = 24/40 (60.00%), Postives = 32/40 (80.00%), Query Frame = 0
BLAST of MS020398 vs. ExPASy TrEMBL
Match: A0A6J1EQN2 (B3 domain-containing protein REM8-like isoform X1 OS=Cucurbita moschata OX=3662 GN=LOC111434972 PE=4 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 3.0e-04 Identity = 24/40 (60.00%), Postives = 30/40 (75.00%), Query Frame = 0
BLAST of MS020398 vs. ExPASy TrEMBL
Match: A0A6J1EJ99 (B3 domain-containing protein REM8-like isoform X2 OS=Cucurbita moschata OX=3662 GN=LOC111434972 PE=4 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 3.0e-04 Identity = 24/40 (60.00%), Postives = 30/40 (75.00%), Query Frame = 0
BLAST of MS020398 vs. ExPASy TrEMBL
Match: A5BWP2 (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VITISV_008016 PE=4 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 4.0e-04 Identity = 26/40 (65.00%), Postives = 31/40 (77.50%), Query Frame = 0
BLAST of MS020398 vs. TAIR 10
Match: AT4G33280.1 (AP2/B3-like transcriptional factor family protein ) HSP 1 Score: 49.7 bits (117), Expect = 6.4e-07 Identity = 19/40 (47.50%), Postives = 29/40 (72.50%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|