![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MS017885 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATTCAGGAAAAACAGATTGTTCCAGCTCGATACAGTCAAGAATTCTTGACTATTGAATGGGAACAAGTTCATCCTTTGAAGTATTTTTCC ATTCAGGAAAAACAGATTGTTCCAGCTCGATACAGTCAAGAATTCTTGACTATTGAATGGGAACAAGTTCATCCTTTGAAGTATTTTTCC ATTCAGGAAAAACAGATTGTTCCAGCTCGATACAGTCAAGAATTCTTGACTATTGAATGGGAACAAGTTCATCCTTTGAAGTATTTTTCC IQEKQIVPARYSQEFLTIEWEQVHPLKYFS Homology
BLAST of MS017885 vs. NCBI nr
Match: QIS91664.1 (RNA polymerase beta subunit [Alberta magna]) HSP 1 Score: 53.1 bits (126), Expect = 4.7e-04 Identity = 26/35 (74.29%), Postives = 28/35 (80.00%), Query Frame = 0
BLAST of MS017885 vs. NCBI nr
Match: YP_009753166.1 (RNA polymerase subunit beta [Trichosanthes truncata] >QIT06238.1 RNA polymerase subunit beta [Trichosanthes truncata]) HSP 1 Score: 52.8 bits (125), Expect = 6.1e-04 Identity = 26/35 (74.29%), Postives = 28/35 (80.00%), Query Frame = 0
BLAST of MS017885 vs. NCBI nr
Match: YP_009236272.1 (RNA polymerase beta subunit [Gynostemma pentaphyllum] >YP_009440149.1 RNA polymerase beta subunit [Gynostemma longipes] >AMF83983.1 RNA polymerase beta subunit [Gynostemma pentaphyllum] >ANI25177.1 RNA polymerase beta subunit [Gynostemma pentaphyllum] >ATG86892.1 RNA polymerase beta subunit [Gynostemma longipes]) HSP 1 Score: 52.8 bits (125), Expect = 6.1e-04 Identity = 26/35 (74.29%), Postives = 28/35 (80.00%), Query Frame = 0
BLAST of MS017885 vs. NCBI nr
Match: YP_009752827.1 (RNA polymerase subunit beta [Baijiania yunnanensis] >QIT05899.1 RNA polymerase subunit beta [Baijiania yunnanensis]) HSP 1 Score: 52.8 bits (125), Expect = 6.1e-04 Identity = 26/35 (74.29%), Postives = 28/35 (80.00%), Query Frame = 0
BLAST of MS017885 vs. NCBI nr
Match: AHM88854.1 (RNA polymerase beta subunit, partial [Lagenaria siceraria]) HSP 1 Score: 52.8 bits (125), Expect = 6.1e-04 Identity = 26/35 (74.29%), Postives = 28/35 (80.00%), Query Frame = 0
BLAST of MS017885 vs. ExPASy Swiss-Prot
Match: Q4VZP1 (DNA-directed RNA polymerase subunit beta OS=Cucumis sativus OX=3659 GN=rpoB PE=3 SV=2) HSP 1 Score: 52.8 bits (125), Expect = 8.0e-07 Identity = 26/35 (74.29%), Postives = 28/35 (80.00%), Query Frame = 0
BLAST of MS017885 vs. ExPASy Swiss-Prot
Match: A0A327 (DNA-directed RNA polymerase subunit beta OS=Coffea arabica OX=13443 GN=rpoB PE=3 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 1.8e-06 Identity = 25/35 (71.43%), Postives = 27/35 (77.14%), Query Frame = 0
BLAST of MS017885 vs. ExPASy Swiss-Prot
Match: Q09X25 (DNA-directed RNA polymerase subunit beta OS=Morus indica OX=248361 GN=rpoB PE=3 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 3.1e-06 Identity = 24/34 (70.59%), Postives = 27/34 (79.41%), Query Frame = 0
BLAST of MS017885 vs. ExPASy Swiss-Prot
Match: A4GGA5 (DNA-directed RNA polymerase subunit beta OS=Phaseolus vulgaris OX=3885 GN=rpoB PE=3 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 4.0e-06 Identity = 25/35 (71.43%), Postives = 27/35 (77.14%), Query Frame = 0
BLAST of MS017885 vs. ExPASy Swiss-Prot
Match: A9LYH7 (DNA-directed RNA polymerase subunit beta OS=Acorus americanus OX=263995 GN=rpoB PE=3 SV=1) HSP 1 Score: 50.1 bits (118), Expect = 5.2e-06 Identity = 24/35 (68.57%), Postives = 27/35 (77.14%), Query Frame = 0
BLAST of MS017885 vs. ExPASy TrEMBL
Match: A0A6H0DRK6 (DNA-directed RNA polymerase subunit beta OS=Alberta magna OX=73951 GN=rpoB PE=3 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 2.3e-04 Identity = 26/35 (74.29%), Postives = 28/35 (80.00%), Query Frame = 0
BLAST of MS017885 vs. ExPASy TrEMBL
Match: A0A218KG28 (DNA-directed RNA polymerase subunit beta OS=Cucumis sativus var. hardwickii OX=319220 GN=rpoB PE=3 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 3.0e-04 Identity = 26/35 (74.29%), Postives = 28/35 (80.00%), Query Frame = 0
BLAST of MS017885 vs. ExPASy TrEMBL
Match: A0A6H0ETN6 (DNA-directed RNA polymerase subunit beta OS=Trichosanthes kirilowii OX=3677 GN=rpoB PE=3 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 3.0e-04 Identity = 26/35 (74.29%), Postives = 28/35 (80.00%), Query Frame = 0
BLAST of MS017885 vs. ExPASy TrEMBL
Match: A0A1X9Q1B9 (DNA-directed RNA polymerase subunit beta OS=Cucumis sativus OX=3659 GN=rpoB PE=3 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 3.0e-04 Identity = 26/35 (74.29%), Postives = 28/35 (80.00%), Query Frame = 0
BLAST of MS017885 vs. ExPASy TrEMBL
Match: A0A249RZI0 (DNA-directed RNA polymerase subunit beta OS=Cucumis melo var. cantalupensis OX=3658 GN=rpoB PE=3 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 3.0e-04 Identity = 26/35 (74.29%), Postives = 28/35 (80.00%), Query Frame = 0
BLAST of MS017885 vs. TAIR 10
Match: ATCG00190.1 (RNA polymerase subunit beta ) HSP 1 Score: 47.4 bits (111), Expect = 2.4e-06 Identity = 23/35 (65.71%), Postives = 26/35 (74.29%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
|