![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MS017796 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TTCAAATGCAAAACGTGCAACAAGTCATTTAGGTCGTATCAAGCATTGGGAGGGCACAAGGCGAGCCACAGGAAGATTAGAACAGAAGATTGTGTTCATCAGAAAGTTTTTCAATGTCCATTTTGCCCCAAAGTGTTTGAATCTGGACAGGCACTTGGAGGGCACAAGAAGGTCCATTTCTTTAAGAAAATTTATCCTAAAAAATTTGGTAAAAACTCCATTGATCTCAACCGTCCACCTCCTGCTTATGATTATGATGAAGATGATGAAGATGAAGTTTCTGAAATTGAATTCTCTGCAATCTCCAAT TTCAAATGCAAAACGTGCAACAAGTCATTTAGGTCGTATCAAGCATTGGGAGGGCACAAGGCGAGCCACAGGAAGATTAGAACAGAAGATTGTGTTCATCAGAAAGTTTTTCAATGTCCATTTTGCCCCAAAGTGTTTGAATCTGGACAGGCACTTGGAGGGCACAAGAAGGTCCATTTCTTTAAGAAAATTTATCCTAAAAAATTTGGTAAAAACTCCATTGATCTCAACCGTCCACCTCCTGCTTATGATTATGATGAAGATGATGAAGATGAAGTTTCTGAAATTGAATTCTCTGCAATCTCCAAT TTCAAATGCAAAACGTGCAACAAGTCATTTAGGTCGTATCAAGCATTGGGAGGGCACAAGGCGAGCCACAGGAAGATTAGAACAGAAGATTGTGTTCATCAGAAAGTTTTTCAATGTCCATTTTGCCCCAAAGTGTTTGAATCTGGACAGGCACTTGGAGGGCACAAGAAGGTCCATTTCTTTAAGAAAATTTATCCTAAAAAATTTGGTAAAAACTCCATTGATCTCAACCGTCCACCTCCTGCTTATGATTATGATGAAGATGATGAAGATGAAGTTTCTGAAATTGAATTCTCTGCAATCTCCAAT FKCKTCNKSFRSYQALGGHKASHRKIRTEDCVHQKVFQCPFCPKVFESGQALGGHKKVHFFKKIYPKKFGKNSIDLNRPPPAYDYDEDDEDEVSEIEFSAISN Homology
BLAST of MS017796 vs. NCBI nr
Match: XP_022158577.1 (zinc finger protein ZAT1-like [Momordica charantia]) HSP 1 Score: 210.3 bits (534), Expect = 7.9e-51 Identity = 99/103 (96.12%), Postives = 100/103 (97.09%), Query Frame = 0
BLAST of MS017796 vs. NCBI nr
Match: KAB1210878.1 (Zinc finger protein ZAT9 [Morella rubra]) HSP 1 Score: 119.8 bits (299), Expect = 1.4e-23 Identity = 65/125 (52.00%), Postives = 78/125 (62.40%), Query Frame = 0
BLAST of MS017796 vs. NCBI nr
Match: KAE8022344.1 (hypothetical protein FH972_008149 [Carpinus fangiana]) HSP 1 Score: 109.8 bits (273), Expect = 1.4e-20 Identity = 59/121 (48.76%), Postives = 75/121 (61.98%), Query Frame = 0
BLAST of MS017796 vs. NCBI nr
Match: EEF51574.1 (zinc finger protein, putative [Ricinus communis]) HSP 1 Score: 107.1 bits (266), Expect = 9.4e-20 Identity = 62/126 (49.21%), Postives = 75/126 (59.52%), Query Frame = 0
BLAST of MS017796 vs. NCBI nr
Match: KAF5935731.1 (hypothetical protein HYC85_026860 [Camellia sinensis]) HSP 1 Score: 107.1 bits (266), Expect = 9.4e-20 Identity = 54/110 (49.09%), Postives = 73/110 (66.36%), Query Frame = 0
BLAST of MS017796 vs. ExPASy Swiss-Prot
Match: Q9M202 (Zinc finger protein ZAT9 OS=Arabidopsis thaliana OX=3702 GN=ZAT9 PE=2 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 9.5e-15 Identity = 47/120 (39.17%), Postives = 66/120 (55.00%), Query Frame = 0
BLAST of MS017796 vs. ExPASy Swiss-Prot
Match: Q9SHD0 (Zinc finger protein ZAT4 OS=Arabidopsis thaliana OX=3702 GN=ZAT4 PE=2 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 6.1e-14 Identity = 38/72 (52.78%), Postives = 48/72 (66.67%), Query Frame = 0
BLAST of MS017796 vs. ExPASy Swiss-Prot
Match: Q39092 (Zinc finger protein ZAT1 OS=Arabidopsis thaliana OX=3702 GN=ZAT1 PE=2 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 6.8e-13 Identity = 46/117 (39.32%), Postives = 65/117 (55.56%), Query Frame = 0
BLAST of MS017796 vs. ExPASy Swiss-Prot
Match: Q9LFG0 (Zinc finger protein ZAT18 OS=Arabidopsis thaliana OX=3702 GN=ZAT18 PE=2 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 6.3e-11 Identity = 31/67 (46.27%), Postives = 44/67 (65.67%), Query Frame = 0
BLAST of MS017796 vs. ExPASy Swiss-Prot
Match: Q9SSW0 (Zinc finger protein AZF3 OS=Arabidopsis thaliana OX=3702 GN=AZF3 PE=1 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 8.3e-11 Identity = 32/67 (47.76%), Postives = 40/67 (59.70%), Query Frame = 0
BLAST of MS017796 vs. ExPASy TrEMBL
Match: A0A6J1DXK2 (zinc finger protein ZAT1-like OS=Momordica charantia OX=3673 GN=LOC111025030 PE=4 SV=1) HSP 1 Score: 210.3 bits (534), Expect = 3.8e-51 Identity = 99/103 (96.12%), Postives = 100/103 (97.09%), Query Frame = 0
BLAST of MS017796 vs. ExPASy TrEMBL
Match: A0A6A1VGE4 (Zinc finger protein ZAT9 OS=Morella rubra OX=262757 GN=CJ030_MR6G019731 PE=4 SV=1) HSP 1 Score: 119.8 bits (299), Expect = 6.8e-24 Identity = 65/125 (52.00%), Postives = 78/125 (62.40%), Query Frame = 0
BLAST of MS017796 vs. ExPASy TrEMBL
Match: A0A5N6R157 (Uncharacterized protein OS=Carpinus fangiana OX=176857 GN=FH972_008149 PE=4 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 7.0e-21 Identity = 59/121 (48.76%), Postives = 75/121 (61.98%), Query Frame = 0
BLAST of MS017796 vs. ExPASy TrEMBL
Match: B9R9U7 (Zinc finger protein, putative OS=Ricinus communis OX=3988 GN=RCOM_1500710 PE=4 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 4.5e-20 Identity = 62/126 (49.21%), Postives = 75/126 (59.52%), Query Frame = 0
BLAST of MS017796 vs. ExPASy TrEMBL
Match: A0A7J7G712 (Uncharacterized protein OS=Camellia sinensis OX=4442 GN=HYC85_026860 PE=4 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 4.5e-20 Identity = 54/110 (49.09%), Postives = 73/110 (66.36%), Query Frame = 0
BLAST of MS017796 vs. TAIR 10
Match: AT3G60580.1 (C2H2-like zinc finger protein ) HSP 1 Score: 80.9 bits (198), Expect = 6.7e-16 Identity = 47/120 (39.17%), Postives = 66/120 (55.00%), Query Frame = 0
BLAST of MS017796 vs. TAIR 10
Match: AT2G45120.1 (C2H2-like zinc finger protein ) HSP 1 Score: 78.2 bits (191), Expect = 4.4e-15 Identity = 38/72 (52.78%), Postives = 48/72 (66.67%), Query Frame = 0
BLAST of MS017796 vs. TAIR 10
Match: AT1G02030.1 (C2H2-like zinc finger protein ) HSP 1 Score: 74.7 bits (182), Expect = 4.8e-14 Identity = 46/117 (39.32%), Postives = 65/117 (55.56%), Query Frame = 0
BLAST of MS017796 vs. TAIR 10
Match: AT5G61470.1 (C2H2-like zinc finger protein ) HSP 1 Score: 68.6 bits (166), Expect = 3.4e-12 Identity = 30/70 (42.86%), Postives = 43/70 (61.43%), Query Frame = 0
BLAST of MS017796 vs. TAIR 10
Match: AT3G53600.1 (C2H2-type zinc finger family protein ) HSP 1 Score: 68.2 bits (165), Expect = 4.5e-12 Identity = 31/67 (46.27%), Postives = 44/67 (65.67%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|