
MS016976 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.GGTAAAACTACAGTAGCCACAGATACGATTCTCAATCAACAAGGGGAAAATGTAATATGTGTTCATGTAGTTATTGGTCAAAAAACATCTTCTGTGGTTCAAGTAGTGACTACTTTACAGGAAATGAGGCAATGGAATACACTATTATAGTAGCTGAAACGGCGGATTCTCTGGCTACAGTACAATACCTTACTCCTTAT GGTAAAACTACAGTAGCCACAGATACGATTCTCAATCAACAAGGGGAAAATGTAATATGTGTTCATGTAGTTATTGGTCAAAAAACATCTTCTGTGGTTCAAGTAGTGACTACTTTACAGGAAATGGCAATGGAATACACTATTATAGTAGCTGAAACGGCGGATTCTCTGGCTACAGTACAATACCTTACTCCTTAT GGTAAAACTACAGTAGCCACAGATACGATTCTCAATCAACAAGGGGAAAATGTAATATGTGTTCATGTAGTTATTGGTCAAAAAACATCTTCTGTGGTTCAAGTAGTGACTACTTTACAGGAAATGGCAATGGAATACACTATTATAGTAGCTGAAACGGCGGATTCTCTGGCTACAGTACAATACCTTACTCCTTAT GKTTVATDTILNQQGENVICVHVVIGQKTSSVVQVVTTLQEMAMEYTIIVAETADSLATVQYLTPY Homology
BLAST of MS016976 vs. NCBI nr
Match: YP_009236266.1 (ATP synthase CF1 alpha subunit [Gynostemma pentaphyllum] >YP_009430612.1 ATP synthase CF1 alpha subunit [Gynostemma cardiospermum] >YP_009439789.1 ATP synthase CF1 alpha subunit [Gynostemma laxiflorum] >YP_009440142.1 ATP synthase CF1 alpha subunit [Gynostemma longipes] >YP_009440316.1 ATP synthase CF1 alpha subunit [Gynostemma pubescens] >QIT05723.1 CF1 subunit alpha [Gynostemma burmanicum (nom. inval.)] >AMF83996.1 ATP synthase CF1 alpha subunit [Gynostemma pentaphyllum] >ANI25170.1 ATP synthase CF1 alpha subunit [Gynostemma pentaphyllum] >ART64976.1 ATP synthase CF1 alpha subunit [Gynostemma pentaphyllum] >ART65063.1 ATP synthase CF1 alpha subunit [Gynostemma cardiospermum]) HSP 1 Score: 101.7 bits (252), Expect = 2.5e-18 Identity = 56/67 (83.58%), Postives = 60/67 (89.55%), Query Frame = 0
BLAST of MS016976 vs. NCBI nr
Match: YP_009439876.1 (ATP synthase CF1 alpha subunit [Gynostemma caulopterum] >YP_009468846.1 ATP synthase CF1 alpha subunit [Gynostemma compressum] >ATG86729.1 ATP synthase CF1 alpha subunit [Gynostemma caulopterum] >AVA29820.1 ATP synthase CF1 alpha subunit [Gynostemma compressum]) HSP 1 Score: 101.7 bits (252), Expect = 2.5e-18 Identity = 56/67 (83.58%), Postives = 60/67 (89.55%), Query Frame = 0
BLAST of MS016976 vs. NCBI nr
Match: YP_009439963.1 (ATP synthase CF1 alpha subunit [Gynostemma pentagynum] >ATG86816.1 ATP synthase CF1 alpha subunit [Gynostemma pentagynum]) HSP 1 Score: 101.7 bits (252), Expect = 2.5e-18 Identity = 56/67 (83.58%), Postives = 60/67 (89.55%), Query Frame = 0
BLAST of MS016976 vs. NCBI nr
Match: YP_010015124.1 (ATP synthase CF1 alpha subunit [Gynostemma yixingense] >QOI14249.1 ATP synthase CF1 alpha subunit [Gynostemma yixingense]) HSP 1 Score: 101.7 bits (252), Expect = 2.5e-18 Identity = 56/67 (83.58%), Postives = 60/67 (89.55%), Query Frame = 0
BLAST of MS016976 vs. NCBI nr
Match: YP_009454432.1 (ATP synthase CF1 alpha subunit [Daniellia pilosa] >AUF70219.1 ATP synthase CF1 alpha subunit [Daniellia pilosa]) HSP 1 Score: 101.3 bits (251), Expect = 3.3e-18 Identity = 56/67 (83.58%), Postives = 60/67 (89.55%), Query Frame = 0
BLAST of MS016976 vs. ExPASy Swiss-Prot
Match: Q8S8Y3 (ATP synthase subunit alpha, chloroplastic OS=Atropa belladonna OX=33113 GN=atpA PE=3 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 1.3e-20 Identity = 55/67 (82.09%), Postives = 59/67 (88.06%), Query Frame = 0
BLAST of MS016976 vs. ExPASy Swiss-Prot
Match: B1NWD5 (ATP synthase subunit alpha, chloroplastic OS=Manihot esculenta OX=3983 GN=atpA PE=3 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 1.3e-20 Identity = 55/67 (82.09%), Postives = 59/67 (88.06%), Query Frame = 0
BLAST of MS016976 vs. ExPASy Swiss-Prot
Match: Q09X32 (ATP synthase subunit alpha, chloroplastic OS=Morus indica OX=248361 GN=atpA PE=3 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 1.3e-20 Identity = 55/67 (82.09%), Postives = 59/67 (88.06%), Query Frame = 0
BLAST of MS016976 vs. ExPASy Swiss-Prot
Match: Q3C1H4 (ATP synthase subunit alpha, chloroplastic OS=Nicotiana sylvestris OX=4096 GN=atpA PE=3 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 1.3e-20 Identity = 55/67 (82.09%), Postives = 59/67 (88.06%), Query Frame = 0
BLAST of MS016976 vs. ExPASy Swiss-Prot
Match: Q33C53 (ATP synthase subunit alpha, chloroplastic OS=Nicotiana tomentosiformis OX=4098 GN=atpA PE=3 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 1.3e-20 Identity = 55/67 (82.09%), Postives = 59/67 (88.06%), Query Frame = 0
BLAST of MS016976 vs. ExPASy TrEMBL
Match: A0A109WWJ5 (ATP synthase subunit alpha, chloroplastic OS=Gynostemma pentaphyllum OX=182084 GN=atpA PE=3 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 1.2e-18 Identity = 56/67 (83.58%), Postives = 60/67 (89.55%), Query Frame = 0
BLAST of MS016976 vs. ExPASy TrEMBL
Match: A0A2L0WR06 (ATP synthase subunit alpha, chloroplastic OS=Gynostemma compressum OX=1348125 GN=atpA PE=3 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 1.2e-18 Identity = 56/67 (83.58%), Postives = 60/67 (89.55%), Query Frame = 0
BLAST of MS016976 vs. ExPASy TrEMBL
Match: A0A291IB12 (ATP synthase subunit alpha, chloroplastic OS=Gynostemma longipes OX=555431 GN=atpA PE=3 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 1.2e-18 Identity = 56/67 (83.58%), Postives = 60/67 (89.55%), Query Frame = 0
BLAST of MS016976 vs. ExPASy TrEMBL
Match: A0A291IAW7 (ATP synthase subunit alpha, chloroplastic OS=Gynostemma pentagynum OX=555432 GN=atpA PE=3 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 1.2e-18 Identity = 56/67 (83.58%), Postives = 60/67 (89.55%), Query Frame = 0
BLAST of MS016976 vs. ExPASy TrEMBL
Match: A0A291IAL8 (ATP synthase subunit alpha, chloroplastic OS=Gynostemma caulopterum OX=1592219 GN=atpA PE=3 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 1.2e-18 Identity = 56/67 (83.58%), Postives = 60/67 (89.55%), Query Frame = 0
BLAST of MS016976 vs. TAIR 10
Match: ATCG00120.1 (ATP synthase subunit alpha ) HSP 1 Score: 98.2 bits (243), Expect = 2.6e-21 Identity = 54/67 (80.60%), Postives = 59/67 (88.06%), Query Frame = 0
BLAST of MS016976 vs. TAIR 10
Match: AT2G07698.1 (ATPase, F1 complex, alpha subunit protein ) HSP 1 Score: 62.8 bits (151), Expect = 1.2e-10 Identity = 38/76 (50.00%), Postives = 51/76 (67.11%), Query Frame = 0
BLAST of MS016976 vs. TAIR 10
Match: ATMG01190.1 (ATP synthase subunit 1 ) HSP 1 Score: 62.8 bits (151), Expect = 1.2e-10 Identity = 38/76 (50.00%), Postives = 51/76 (67.11%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|