MS016523 (gene) Bitter gourd (TR) v1
|
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.AGACAAAGAGAATTAATATATGATCTATTCGAAGCAACCACCGGTATGAGAATGATGCATAATTTTTTTCGTATTAGGGAAGTCGCGACTGATCTACCTTATGGCTGGAAAGTGCAATTATTTTTTGACAGGGATGCTGAGTATCATAAACTTATTACACAAAATCCTATTTTCTACGACAGACAAAGAGAATTAATATATGATCTATTCGAAGCAACCACCGGTATGAGAATGATGCATAATTTTTTTCGTATTAGGGAAGTCGCGACTGATCTACCTTATGGCTGGAAAGTGCAATTATTTTTTGACAGGGATGCTGAGTATCATAAACTTATTACACAAAATCCTATTTTCTACGAC AGACAAAGAGAATTAATATATGATCTATTCGAAGCAACCACCGGTATGAGAATGATGCATAATTTTTTTCGTATTAGGGAAGTCGCGACTGATCTACCTTATGGCTGGAAAGTGCAATTATTTTTTGACAGGGATGCTGAGTATCATAAACTTATTACACAAAATCCTATTTTCTACGAC RQRELIYDLFEATTGMRMMHNFFRIREVATDLPYGWKVQLFFDRDAEYHKLITQNPIFYD Homology
BLAST of MS016523 vs. NCBI nr
Match: YP_010158943.1 (NADH-plastoquinone oxidoreductase subunit 7 [Alysicarpus vaginalis] >QRG31223.1 NADH-plastoquinone oxidoreductase subunit 7 [Alysicarpus vaginalis]) HSP 1 Score: 89.0 bits (219), Expect = 1.5e-14 Identity = 45/66 (68.18%), Postives = 48/66 (72.73%), Query Frame = 0
BLAST of MS016523 vs. NCBI nr
Match: YP_009974360.1 (NADH-plastoquinone oxidoreductase subunit 7 [Uraria lagopodoides] >QNH95217.1 NADH-plastoquinone oxidoreductase subunit 7 [Uraria lagopodoides]) HSP 1 Score: 89.0 bits (219), Expect = 1.5e-14 Identity = 45/66 (68.18%), Postives = 48/66 (72.73%), Query Frame = 0
BLAST of MS016523 vs. NCBI nr
Match: YP_009680687.1 (NADH dehydrogenase subunit 7 [Grona heterocarpos] >YP_009747462.1 NADH dehydrogenase subunit 7 [Grona styracifolia] >AYA54365.1 NADH dehydrogenase subunit 7 [Grona heterocarpos] >QII68625.1 NADH dehydrogenase subunit 7 [Grona styracifolia]) HSP 1 Score: 89.0 bits (219), Expect = 1.5e-14 Identity = 45/66 (68.18%), Postives = 48/66 (72.73%), Query Frame = 0
BLAST of MS016523 vs. NCBI nr
Match: YP_010033616.1 (NADH-plastoquinone oxidoreductase subunit 7 [Christia vespertilionis] >QOW40654.1 NADH-plastoquinone oxidoreductase subunit 7 [Christia vespertilionis]) HSP 1 Score: 89.0 bits (219), Expect = 1.5e-14 Identity = 45/66 (68.18%), Postives = 48/66 (72.73%), Query Frame = 0
BLAST of MS016523 vs. NCBI nr
Match: YP_010033699.1 (NADH-plastoquinone oxidoreductase subunit 7 [Urariopsis brevissima] >QOW40690.1 NADH-plastoquinone oxidoreductase subunit 7 [Urariopsis brevissima]) HSP 1 Score: 89.0 bits (219), Expect = 1.5e-14 Identity = 45/66 (68.18%), Postives = 48/66 (72.73%), Query Frame = 0
BLAST of MS016523 vs. ExPASy Swiss-Prot
Match: Q2PMN8 (NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Glycine max OX=3847 GN=ndhH PE=3 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 4.5e-17 Identity = 44/66 (66.67%), Postives = 47/66 (71.21%), Query Frame = 0
BLAST of MS016523 vs. ExPASy Swiss-Prot
Match: A4GGF2 (NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Phaseolus vulgaris OX=3885 GN=ndhH PE=3 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 2.2e-16 Identity = 43/66 (65.15%), Postives = 46/66 (69.70%), Query Frame = 0
BLAST of MS016523 vs. ExPASy Swiss-Prot
Match: A6MMQ7 (NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Dioscorea elephantipes OX=145284 GN=ndhH PE=3 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 2.9e-16 Identity = 42/66 (63.64%), Postives = 48/66 (72.73%), Query Frame = 0
BLAST of MS016523 vs. ExPASy Swiss-Prot
Match: Q06GL1 (NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Piper cenocladum OX=398741 GN=ndhH PE=3 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 2.9e-16 Identity = 43/66 (65.15%), Postives = 48/66 (72.73%), Query Frame = 0
BLAST of MS016523 vs. ExPASy Swiss-Prot
Match: Q9BBN8 (NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Lotus japonicus OX=34305 GN=ndhH PE=3 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 5.0e-16 Identity = 42/66 (63.64%), Postives = 46/66 (69.70%), Query Frame = 0
BLAST of MS016523 vs. ExPASy TrEMBL
Match: A0A7S7ACI9 (NADH-plastoquinone oxidoreductase subunit 7 OS=Christia vespertilionis OX=587866 GN=ndhH PE=4 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 7.5e-15 Identity = 45/66 (68.18%), Postives = 48/66 (72.73%), Query Frame = 0
BLAST of MS016523 vs. ExPASy TrEMBL
Match: A0A6H0EFW2 (NADH-quinone oxidoreductase subunit D OS=Huangtcia renifolia OX=670325 GN=ndhH PE=3 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 7.5e-15 Identity = 45/66 (68.18%), Postives = 48/66 (72.73%), Query Frame = 0
BLAST of MS016523 vs. ExPASy TrEMBL
Match: A0A510BUQ4 (NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Grona heterocarpos OX=499991 GN=ndhH PE=3 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 7.5e-15 Identity = 45/66 (68.18%), Postives = 48/66 (72.73%), Query Frame = 0
BLAST of MS016523 vs. ExPASy TrEMBL
Match: A0A7S7ACB4 (NADH-plastoquinone oxidoreductase subunit 7 OS=Urariopsis brevissima OX=2783717 GN=ndhH PE=4 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 7.5e-15 Identity = 45/66 (68.18%), Postives = 48/66 (72.73%), Query Frame = 0
BLAST of MS016523 vs. ExPASy TrEMBL
Match: A0A7G7YL47 (NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Uraria lagopodoides OX=1048768 GN=ndhH PE=3 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 7.5e-15 Identity = 45/66 (68.18%), Postives = 48/66 (72.73%), Query Frame = 0
BLAST of MS016523 vs. TAIR 10
Match: ATCG01110.1 (NAD(P)H dehydrogenase subunit H ) HSP 1 Score: 81.3 bits (199), Expect = 3.0e-16 Identity = 39/66 (59.09%), Postives = 44/66 (66.67%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|