MS016508 (gene) Bitter gourd (TR) v1
|
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GTATGGACTTTTAGTTTAATGTTTCTATTCAGCGGGTGTGATTATTGGCAAGAACTTATTAAATCCATCGCTTGGGCTCATAATAAATTAAAAGTTGCTCCTGCTACTCAACCTGGAGTCTTGAGCATTGTCTAATGACGCGGTAGGAGTAACCCATTACATTCTGGGAGGAGAAAAGATGGGTGGTATTCATATACTAAGGGAAAATTGTTTTGTCCACGTATGGACTTTTAGTTTAATGTTTCTATTCAGCGGGTGTGATTATTGGCAAGAACTTATTAAATCCATCGCTTGGGCTCATAATAAATTAAAAGTTGCTCCTGCTACTCAACCTGGAGTCTTGAGCATTGTCAATGACGCGGTAGGAGTAACCCATTACATTCTGGGAGGAGAAAAGATGGGTGGTATTCATATACTAAGGGAAAATTGTTTTGTCCAC GTATGGACTTTTAGTTTAATGTTTCTATTCAGCGGGTGTGATTATTGGCAAGAACTTATTAAATCCATCGCTTGGGCTCATAATAAATTAAAAGTTGCTCCTGCTACTCAACCTGGAGTCTTGAGCATTGTCAATGACGCGGTAGGAGTAACCCATTACATTCTGGGAGGAGAAAAGATGGGTGGTATTCATATACTAAGGGAAAATTGTTTTGTCCAC VWTFSLMFLFSGCDYWQELIKSIAWAHNKLKVAPATQPGVLSIVNDAVGVTHYILGGEKMGGIHILRENCFVH Homology
BLAST of MS016508 vs. NCBI nr
Match: PNT40931.1 (hypothetical protein POPTR_004G127600, partial [Populus trichocarpa]) HSP 1 Score: 97.4 bits (241), Expect = 5.3e-17 Identity = 43/57 (75.44%), Postives = 48/57 (84.21%), Query Frame = 0
BLAST of MS016508 vs. NCBI nr
Match: YP_009862964.1 (photosystem I P700 apoprotein A1 [Anthoceros punctatus] >QKD76420.1 photosystem I P700 apoprotein A1 [Anthoceros punctatus]) HSP 1 Score: 96.7 bits (239), Expect = 9.0e-17 Identity = 46/58 (79.31%), Postives = 48/58 (82.76%), Query Frame = 0
BLAST of MS016508 vs. NCBI nr
Match: RYQ91279.1 (hypothetical protein Ahy_B09g097168 isoform A [Arachis hypogaea]) HSP 1 Score: 96.7 bits (239), Expect = 9.0e-17 Identity = 47/58 (81.03%), Postives = 50/58 (86.21%), Query Frame = 0
BLAST of MS016508 vs. NCBI nr
Match: YP_009863054.1 (photosystem I P700 apoprotein A1 [Anthoceros agrestis] >QKD76510.1 photosystem I P700 apoprotein A1 [Anthoceros agrestis]) HSP 1 Score: 96.7 bits (239), Expect = 9.0e-17 Identity = 46/58 (79.31%), Postives = 48/58 (82.76%), Query Frame = 0
BLAST of MS016508 vs. NCBI nr
Match: YP_009681135.1 (photosystem I P700 apoprotein A1 [Sagittaria trifolia] >QDG01474.1 photosystem I P700 apoprotein A1 [Sagittaria trifolia]) HSP 1 Score: 96.3 bits (238), Expect = 1.2e-16 Identity = 47/58 (81.03%), Postives = 49/58 (84.48%), Query Frame = 0
BLAST of MS016508 vs. ExPASy Swiss-Prot
Match: Q3V534 (Photosystem I P700 chlorophyll a apoprotein A1 OS=Acorus calamus OX=4465 GN=psaA PE=3 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 1.5e-19 Identity = 47/58 (81.03%), Postives = 49/58 (84.48%), Query Frame = 0
BLAST of MS016508 vs. ExPASy Swiss-Prot
Match: A4QJB5 (Photosystem I P700 chlorophyll a apoprotein A1 OS=Aethionema cordifolium OX=434059 GN=psaA PE=3 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 1.5e-19 Identity = 47/58 (81.03%), Postives = 49/58 (84.48%), Query Frame = 0
BLAST of MS016508 vs. ExPASy Swiss-Prot
Match: A4QJJ9 (Photosystem I P700 chlorophyll a apoprotein A1 OS=Aethionema grandiflorum OX=72657 GN=psaA PE=3 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 1.5e-19 Identity = 47/58 (81.03%), Postives = 49/58 (84.48%), Query Frame = 0
BLAST of MS016508 vs. ExPASy Swiss-Prot
Match: Q70Y03 (Photosystem I P700 chlorophyll a apoprotein A1 OS=Amborella trichopoda OX=13333 GN=psaA PE=2 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 1.5e-19 Identity = 47/58 (81.03%), Postives = 49/58 (84.48%), Query Frame = 0
BLAST of MS016508 vs. ExPASy Swiss-Prot
Match: A4QK18 (Photosystem I P700 chlorophyll a apoprotein A1 OS=Arabis hirsuta OX=78191 GN=psaA PE=3 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 1.5e-19 Identity = 47/58 (81.03%), Postives = 49/58 (84.48%), Query Frame = 0
BLAST of MS016508 vs. ExPASy TrEMBL
Match: A0A2K2ATR5 (Uncharacterized protein (Fragment) OS=Populus trichocarpa OX=3694 GN=POPTR_004G127600 PE=4 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 2.6e-17 Identity = 43/57 (75.44%), Postives = 48/57 (84.21%), Query Frame = 0
BLAST of MS016508 vs. ExPASy TrEMBL
Match: A0A6M8B1J4 (Photosystem I P700 chlorophyll a apoprotein A1 OS=Anthoceros punctatus OX=3234 GN=psaA PE=3 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 4.4e-17 Identity = 46/58 (79.31%), Postives = 48/58 (82.76%), Query Frame = 0
BLAST of MS016508 vs. ExPASy TrEMBL
Match: A0A6M8B216 (Photosystem I P700 chlorophyll a apoprotein A1 OS=Anthoceros agrestis OX=41834 GN=psaA PE=3 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 4.4e-17 Identity = 46/58 (79.31%), Postives = 48/58 (82.76%), Query Frame = 0
BLAST of MS016508 vs. ExPASy TrEMBL
Match: A0A444XNJ3 (Uncharacterized protein OS=Arachis hypogaea OX=3818 GN=Ahy_B09g097168 PE=4 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 4.4e-17 Identity = 47/58 (81.03%), Postives = 50/58 (86.21%), Query Frame = 0
BLAST of MS016508 vs. ExPASy TrEMBL
Match: A0A481XQM4 (Photosystem I P700 chlorophyll a apoprotein A1 OS=Holcoglossum nujiangense OX=536150 GN=psaA PE=3 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 5.7e-17 Identity = 47/58 (81.03%), Postives = 49/58 (84.48%), Query Frame = 0
BLAST of MS016508 vs. TAIR 10
Match: ATCG00350.1 (Photosystem I, PsaA/PsaB protein ) HSP 1 Score: 95.9 bits (237), Expect = 1.4e-20 Identity = 46/58 (79.31%), Postives = 49/58 (84.48%), Query Frame = 0
BLAST of MS016508 vs. TAIR 10
Match: ATCG00340.1 (Photosystem I, PsaA/PsaB protein ) HSP 1 Score: 48.1 bits (113), Expect = 3.4e-06 Identity = 26/61 (42.62%), Postives = 35/61 (57.38%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|