
MS013281 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GCGGCGATCGCAATCGCAACCGCAATGCTACTGCTGGTGTTTGAAGGATACGCTCAAGAACAAGAGACACGGTGCGTGAACAGGTTAATTCCCTGCTTAAGTTACCTCAACGGAACCCGAGACCCGCCGGAGAGTTGTTGTGATCCTCTGAGACGGGTGATCGAGTCGAATCCAGATTGCATTTGCAGTTTAATTAGCATGGAGGGAAGCAATCGAGCGGAGCAGGTTGGCATTGATGTCAACGAGGCTCAACAGCTGCCTGGCAGATGTGGGCAACATGTCAATCCACTCTCC GCGGCGATCGCAATCGCAACCGCAATGCTACTGCTGGTGTTTGAAGGATACGCTCAAGAACAAGAGACACGGTGCGTGAACAGGTTAATTCCCTGCTTAAGTTACCTCAACGGAACCCGAGACCCGCCGGAGAGTTGTTGTGATCCTCTGAGACGGGTGATCGAGTCGAATCCAGATTGCATTTGCAGTTTAATTAGCATGGAGGGAAGCAATCGAGCGGAGCAGGTTGGCATTGATGTCAACGAGGCTCAACAGCTGCCTGGCAGATGTGGGCAACATGTCAATCCACTCTCC GCGGCGATCGCAATCGCAACCGCAATGCTACTGCTGGTGTTTGAAGGATACGCTCAAGAACAAGAGACACGGTGCGTGAACAGGTTAATTCCCTGCTTAAGTTACCTCAACGGAACCCGAGACCCGCCGGAGAGTTGTTGTGATCCTCTGAGACGGGTGATCGAGTCGAATCCAGATTGCATTTGCAGTTTAATTAGCATGGAGGGAAGCAATCGAGCGGAGCAGGTTGGCATTGATGTCAACGAGGCTCAACAGCTGCCTGGCAGATGTGGGCAACATGTCAATCCACTCTCC AAIAIATAMLLLVFEGYAQEQETRCVNRLIPCLSYLNGTRDPPESCCDPLRRVIESNPDCICSLISMEGSNRAEQVGIDVNEAQQLPGRCGQHVNPLS Homology
BLAST of MS013281 vs. NCBI nr
Match: XP_022148259.1 (lipid transfer-like protein VAS [Momordica charantia]) HSP 1 Score: 200.7 bits (509), Expect = 5.9e-48 Identity = 95/98 (96.94%), Postives = 97/98 (98.98%), Query Frame = 0
BLAST of MS013281 vs. NCBI nr
Match: XP_038901700.1 (non-specific lipid transfer protein GPI-anchored 30 [Benincasa hispida]) HSP 1 Score: 145.2 bits (365), Expect = 3.0e-31 Identity = 65/98 (66.33%), Postives = 78/98 (79.59%), Query Frame = 0
BLAST of MS013281 vs. NCBI nr
Match: KAG6581146.1 (Lipid transfer-like protein VAS, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 144.8 bits (364), Expect = 3.9e-31 Identity = 66/97 (68.04%), Postives = 82/97 (84.54%), Query Frame = 0
BLAST of MS013281 vs. NCBI nr
Match: KAG7017881.1 (Lipid transfer-like protein VAS, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 144.8 bits (364), Expect = 3.9e-31 Identity = 66/97 (68.04%), Postives = 82/97 (84.54%), Query Frame = 0
BLAST of MS013281 vs. NCBI nr
Match: XP_022935175.1 (lipid transfer-like protein VAS [Cucurbita moschata]) HSP 1 Score: 144.1 bits (362), Expect = 6.6e-31 Identity = 65/95 (68.42%), Postives = 81/95 (85.26%), Query Frame = 0
BLAST of MS013281 vs. ExPASy Swiss-Prot
Match: Q9FFY3 (Non-specific lipid transfer protein GPI-anchored 30 OS=Arabidopsis thaliana OX=3702 GN=LTPG30 PE=2 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 2.8e-24 Identity = 44/78 (56.41%), Postives = 63/78 (80.77%), Query Frame = 0
BLAST of MS013281 vs. ExPASy Swiss-Prot
Match: Q9LJ86 (Non-specific lipid transfer protein GPI-anchored 5 OS=Arabidopsis thaliana OX=3702 GN=LTPG5 PE=2 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 5.1e-10 Identity = 33/83 (39.76%), Postives = 51/83 (61.45%), Query Frame = 0
BLAST of MS013281 vs. ExPASy Swiss-Prot
Match: Q6NLF7 (Non-specific lipid transfer protein GPI-anchored 7 OS=Arabidopsis thaliana OX=3702 GN=LTPG7 PE=2 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 9.0e-07 Identity = 29/89 (32.58%), Postives = 45/89 (50.56%), Query Frame = 0
BLAST of MS013281 vs. ExPASy Swiss-Prot
Match: Q1PFD8 (Non-specific lipid transfer protein GPI-anchored 9 OS=Arabidopsis thaliana OX=3702 GN=LTPG9 PE=2 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 1.5e-06 Identity = 32/99 (32.32%), Postives = 50/99 (50.51%), Query Frame = 0
BLAST of MS013281 vs. ExPASy Swiss-Prot
Match: Q9LZH5 (Non-specific lipid transfer protein GPI-anchored 2 OS=Arabidopsis thaliana OX=3702 GN=LTPG2 PE=2 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 1.3e-05 Identity = 26/67 (38.81%), Postives = 41/67 (61.19%), Query Frame = 0
BLAST of MS013281 vs. ExPASy TrEMBL
Match: A0A6J1D3G9 (lipid transfer-like protein VAS OS=Momordica charantia OX=3673 GN=LOC111016964 PE=3 SV=1) HSP 1 Score: 200.7 bits (509), Expect = 2.9e-48 Identity = 95/98 (96.94%), Postives = 97/98 (98.98%), Query Frame = 0
BLAST of MS013281 vs. ExPASy TrEMBL
Match: A0A6J1F9V7 (lipid transfer-like protein VAS OS=Cucurbita moschata OX=3662 GN=LOC111442128 PE=3 SV=1) HSP 1 Score: 144.1 bits (362), Expect = 3.2e-31 Identity = 65/95 (68.42%), Postives = 81/95 (85.26%), Query Frame = 0
BLAST of MS013281 vs. ExPASy TrEMBL
Match: A0A6J1J1M2 (lipid transfer-like protein VAS OS=Cucurbita maxima OX=3661 GN=LOC111481899 PE=3 SV=1) HSP 1 Score: 143.7 bits (361), Expect = 4.2e-31 Identity = 65/95 (68.42%), Postives = 81/95 (85.26%), Query Frame = 0
BLAST of MS013281 vs. ExPASy TrEMBL
Match: A0A0A0L9L7 (AAI domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_3G250900 PE=3 SV=1) HSP 1 Score: 142.9 bits (359), Expect = 7.1e-31 Identity = 66/100 (66.00%), Postives = 78/100 (78.00%), Query Frame = 0
BLAST of MS013281 vs. ExPASy TrEMBL
Match: A0A5A7U4K4 (Lipid transfer-like protein VAS OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold600G001950 PE=3 SV=1) HSP 1 Score: 141.0 bits (354), Expect = 2.7e-30 Identity = 65/99 (65.66%), Postives = 76/99 (76.77%), Query Frame = 0
BLAST of MS013281 vs. TAIR 10
Match: AT5G13900.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 112.5 bits (280), Expect = 2.0e-25 Identity = 44/78 (56.41%), Postives = 63/78 (80.77%), Query Frame = 0
BLAST of MS013281 vs. TAIR 10
Match: AT3G22600.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 65.1 bits (157), Expect = 3.6e-11 Identity = 33/83 (39.76%), Postives = 51/83 (61.45%), Query Frame = 0
BLAST of MS013281 vs. TAIR 10
Match: AT1G70250.1 (receptor serine/threonine kinase, putative ) HSP 1 Score: 55.5 bits (132), Expect = 2.9e-08 Identity = 27/84 (32.14%), Postives = 46/84 (54.76%), Query Frame = 0
BLAST of MS013281 vs. TAIR 10
Match: AT1G62790.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 54.3 bits (129), Expect = 6.4e-08 Identity = 29/89 (32.58%), Postives = 45/89 (50.56%), Query Frame = 0
BLAST of MS013281 vs. TAIR 10
Match: AT1G62790.2 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 54.3 bits (129), Expect = 6.4e-08 Identity = 29/89 (32.58%), Postives = 45/89 (50.56%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|