
MS013260 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.AGTTCAAAAACCCTACCTAATGGCGTAATAGTTGGAAAGGTAACAAAACTCTATACTTTTCATTACAAAACCAATAAACCTGAAAAAGAT AGTTCAAAAACCCTACCTAATGGCGTAATAGTTGGAAAGGTAACAAAACTCTATACTTTTCATTACAAAACCAATAAACCTGAAAAAGAT AGTTCAAAAACCCTACCTAATGGCGTAATAGTTGGAAAGGTAACAAAACTCTATACTTTTCATTACAAAACCAATAAACCTGAAAAAGAT SSKTLPNGVIVGKVTKLYTFHYKTNKPEKD Homology
BLAST of MS013260 vs. NCBI nr
Match: QRK25587.1 (RNA polymerase beta' subunit [Rhizophora apiculata]) HSP 1 Score: 58.9 bits (141), Expect = 8.5e-06 Identity = 26/30 (86.67%), Postives = 28/30 (93.33%), Query Frame = 0
BLAST of MS013260 vs. NCBI nr
Match: YP_009654938.1 (RpoC1 [Rhizophora stylosa] >YP_009740248.1 RNA polymerase beta' subunit [Rhizophora x lamarckii] >QCI56271.1 RpoC1 [Rhizophora stylosa] >QIC55012.1 RNA polymerase beta' subunit [Rhizophora x lamarckii]) HSP 1 Score: 58.9 bits (141), Expect = 8.5e-06 Identity = 26/30 (86.67%), Postives = 28/30 (93.33%), Query Frame = 0
BLAST of MS013260 vs. NCBI nr
Match: QGX43666.1 (RNA polymerase beta subunit [Rhizophora mucronata]) HSP 1 Score: 58.9 bits (141), Expect = 8.5e-06 Identity = 26/30 (86.67%), Postives = 28/30 (93.33%), Query Frame = 0
BLAST of MS013260 vs. NCBI nr
Match: YP_009752741.1 (RNA polymerase beta' subunit [Cyclantheropsis parviflora] >QIT05391.1 RNA polymerase beta' subunit [Cyclantheropsis parviflora]) HSP 1 Score: 58.5 bits (140), Expect = 1.1e-05 Identity = 26/30 (86.67%), Postives = 28/30 (93.33%), Query Frame = 0
BLAST of MS013260 vs. NCBI nr
Match: YP_009234631.1 (RNA polymerase beta' subunit [Meliosma aff. cuneifolia Moore 333] >ADD31167.1 RNA polymerase beta' subunit protein [Meliosma aff. cuneifolia Moore 333] >AMD08349.1 RNA polymerase beta' subunit [Meliosma aff. cuneifolia Moore 333]) HSP 1 Score: 58.5 bits (140), Expect = 1.1e-05 Identity = 26/30 (86.67%), Postives = 28/30 (93.33%), Query Frame = 0
BLAST of MS013260 vs. ExPASy Swiss-Prot
Match: Q4VZP2 (DNA-directed RNA polymerase subunit beta' OS=Cucumis sativus OX=3659 GN=rpoC1 PE=3 SV=3) HSP 1 Score: 57.4 bits (137), Expect = 3.3e-08 Identity = 25/30 (83.33%), Postives = 28/30 (93.33%), Query Frame = 0
BLAST of MS013260 vs. ExPASy Swiss-Prot
Match: Q7YJX9 (DNA-directed RNA polymerase subunit beta' OS=Calycanthus floridus var. glaucus OX=212734 GN=rpoC1 PE=3 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 4.3e-08 Identity = 24/30 (80.00%), Postives = 28/30 (93.33%), Query Frame = 0
BLAST of MS013260 vs. ExPASy Swiss-Prot
Match: B2LMI1 (DNA-directed RNA polymerase subunit beta' OS=Guizotia abyssinica OX=4230 GN=rpoC1 PE=3 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 9.5e-08 Identity = 25/30 (83.33%), Postives = 26/30 (86.67%), Query Frame = 0
BLAST of MS013260 vs. ExPASy Swiss-Prot
Match: Q1KXX1 (DNA-directed RNA polymerase subunit beta' OS=Helianthus annuus OX=4232 GN=rpoC1 PE=3 SV=2) HSP 1 Score: 55.8 bits (133), Expect = 9.5e-08 Identity = 25/30 (83.33%), Postives = 26/30 (86.67%), Query Frame = 0
BLAST of MS013260 vs. ExPASy Swiss-Prot
Match: Q56P12 (DNA-directed RNA polymerase subunit beta' OS=Lactuca sativa OX=4236 GN=rpoC1 PE=3 SV=2) HSP 1 Score: 55.8 bits (133), Expect = 9.5e-08 Identity = 25/30 (83.33%), Postives = 26/30 (86.67%), Query Frame = 0
BLAST of MS013260 vs. ExPASy TrEMBL
Match: A0A6C0X6I7 (DNA-directed RNA polymerase subunit beta' OS=Rhizophora x lamarckii OX=1333497 GN=rpoC1 PE=3 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 4.1e-06 Identity = 26/30 (86.67%), Postives = 28/30 (93.33%), Query Frame = 0
BLAST of MS013260 vs. ExPASy TrEMBL
Match: A0A4P8D2D1 (DNA-directed RNA polymerase subunit beta' OS=Rhizophora stylosa OX=98588 GN=rpoC1 PE=3 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 4.1e-06 Identity = 26/30 (86.67%), Postives = 28/30 (93.33%), Query Frame = 0
BLAST of MS013260 vs. ExPASy TrEMBL
Match: A0A6B9DDJ9 (DNA-directed RNA polymerase subunit gamma OS=Rhizophora mucronata OX=61149 GN=rpoC1 PE=3 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 4.1e-06 Identity = 26/30 (86.67%), Postives = 28/30 (93.33%), Query Frame = 0
BLAST of MS013260 vs. ExPASy TrEMBL
Match: D3WC15 (DNA-directed RNA polymerase subunit beta' OS=Meliosma aff. cuneifolia Moore 333 OX=723415 GN=rpoC1 PE=3 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 5.4e-06 Identity = 26/30 (86.67%), Postives = 28/30 (93.33%), Query Frame = 0
BLAST of MS013260 vs. ExPASy TrEMBL
Match: A0A6H0ESX8 (DNA-directed RNA polymerase subunit beta' OS=Cyclantheropsis parviflora OX=387129 GN=rpoC1 PE=3 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 5.4e-06 Identity = 26/30 (86.67%), Postives = 28/30 (93.33%), Query Frame = 0
BLAST of MS013260 vs. TAIR 10
Match: ATCG00180.1 (DNA-directed RNA polymerase family protein ) HSP 1 Score: 54.3 bits (129), Expect = 2.0e-08 Identity = 23/30 (76.67%), Postives = 27/30 (90.00%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
|