
MS009862 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.AAAAAACTCATTGTATGGGAAATACTTCAGGAAGTTATGGAGGGTTATCTCGTATTGCTAAATAAAGCGTATACTCTACATAGATTAGGCATCCAAGCG AAAAAACTCATTGTATGGGAAATACTTCAGGAAGTTATGGAGGGTTATCTCGTATTGCTAAATAAAGCGTATACTCTACATAGATTAGGCATCCAAGCG AAAAAACTCATTGTATGGGAAATACTTCAGGAAGTTATGGAGGGTTATCTCGTATTGCTAAATAAAGCGTATACTCTACATAGATTAGGCATCCAAGCG KKLIVWEILQEVMEGYLVLLNKAYTLHRLGIQA Homology
BLAST of MS009862 vs. NCBI nr
Match: AWH98273.1 (RNA polymerase beta subunit, partial [Odontadenia sp. ITV658]) HSP 1 Score: 57.8 bits (138), Expect = 2.1e-05 Identity = 29/33 (87.88%), Postives = 31/33 (93.94%), Query Frame = 0
BLAST of MS009862 vs. NCBI nr
Match: AWI72718.1 (RNA polymerase beta' subunit [Metastelma northropiae]) HSP 1 Score: 55.8 bits (133), Expect = 8.0e-05 Identity = 28/33 (84.85%), Postives = 30/33 (90.91%), Query Frame = 0
BLAST of MS009862 vs. NCBI nr
Match: YP_010116599.1 (RNA polymerase beta' subunit [Cakile maritima subsp. baltica] >QJF66939.1 RNA polymerase beta' subunit [Cakile maritima subsp. baltica]) HSP 1 Score: 55.5 bits (132), Expect = 1.0e-04 Identity = 27/33 (81.82%), Postives = 31/33 (93.94%), Query Frame = 0
BLAST of MS009862 vs. NCBI nr
Match: YP_009353220.1 (RNA polymerase beta [Passiflora edulis] >APL97541.1 RNA polymerase beta [Passiflora edulis]) HSP 1 Score: 55.5 bits (132), Expect = 1.0e-04 Identity = 28/33 (84.85%), Postives = 30/33 (90.91%), Query Frame = 0
BLAST of MS009862 vs. NCBI nr
Match: ABU79845.1 (RNA polymerase C, partial [Adiantum venustum] >ABU79906.1 RNA polymerase C, partial [Passiflora incarnata]) HSP 1 Score: 55.5 bits (132), Expect = 1.0e-04 Identity = 28/33 (84.85%), Postives = 30/33 (90.91%), Query Frame = 0
BLAST of MS009862 vs. ExPASy Swiss-Prot
Match: P56763 (DNA-directed RNA polymerase subunit beta' OS=Arabidopsis thaliana OX=3702 GN=rpoC1 PE=3 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 8.8e-07 Identity = 26/33 (78.79%), Postives = 30/33 (90.91%), Query Frame = 0
BLAST of MS009862 vs. ExPASy Swiss-Prot
Match: A4QK96 (DNA-directed RNA polymerase subunit beta' OS=Barbarea verna OX=50458 GN=rpoC1 PE=3 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 8.8e-07 Identity = 26/33 (78.79%), Postives = 30/33 (90.91%), Query Frame = 0
BLAST of MS009862 vs. ExPASy Swiss-Prot
Match: A4QKI3 (DNA-directed RNA polymerase subunit beta' OS=Capsella bursa-pastoris OX=3719 GN=rpoC1 PE=3 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 8.8e-07 Identity = 26/33 (78.79%), Postives = 30/33 (90.91%), Query Frame = 0
BLAST of MS009862 vs. ExPASy Swiss-Prot
Match: A4QKS2 (DNA-directed RNA polymerase subunit beta' OS=Crucihimalaya wallichii OX=78192 GN=rpoC1 PE=3 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 8.8e-07 Identity = 26/33 (78.79%), Postives = 30/33 (90.91%), Query Frame = 0
BLAST of MS009862 vs. ExPASy Swiss-Prot
Match: A4QL10 (DNA-directed RNA polymerase subunit beta' OS=Draba nemorosa OX=171822 GN=rpoC1 PE=3 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 8.8e-07 Identity = 26/33 (78.79%), Postives = 30/33 (90.91%), Query Frame = 0
BLAST of MS009862 vs. ExPASy TrEMBL
Match: A0A2S1RF10 (DNA-directed RNA polymerase (Fragment) OS=Odontadenia sp. ITV658 OX=2182527 GN=rpoc1 PE=4 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 1.0e-05 Identity = 29/33 (87.88%), Postives = 31/33 (93.94%), Query Frame = 0
BLAST of MS009862 vs. ExPASy TrEMBL
Match: A0A2S1UCK5 (DNA-directed RNA polymerase subunit beta' OS=Metastelma northropiae OX=1254457 GN=rpoC1 PE=3 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 3.9e-05 Identity = 28/33 (84.85%), Postives = 30/33 (90.91%), Query Frame = 0
BLAST of MS009862 vs. ExPASy TrEMBL
Match: A0A2Z5D582 (DNA-directed RNA polymerase subunit beta' OS=Passiflora edulis OX=78168 GN=rpoC1 PE=3 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 5.0e-05 Identity = 28/33 (84.85%), Postives = 30/33 (90.91%), Query Frame = 0
BLAST of MS009862 vs. ExPASy TrEMBL
Match: A0A7M1CF63 (DNA-directed RNA polymerase subunit beta' OS=Passiflora caerulea OX=159428 GN=rpoC1 PE=3 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 5.0e-05 Identity = 28/33 (84.85%), Postives = 30/33 (90.91%), Query Frame = 0
BLAST of MS009862 vs. ExPASy TrEMBL
Match: A7XWS1 (DNA-directed RNA polymerase (Fragment) OS=Adiantum venustum OX=446141 GN=rpoC1 PE=4 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 5.0e-05 Identity = 28/33 (84.85%), Postives = 30/33 (90.91%), Query Frame = 0
BLAST of MS009862 vs. TAIR 10
Match: ATCG00180.1 (DNA-directed RNA polymerase family protein ) HSP 1 Score: 52.8 bits (125), Expect = 6.3e-08 Identity = 26/33 (78.79%), Postives = 30/33 (90.91%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
|