
MS007785 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TTGTTGTTGTTGTTACCCGTTAGCCTACATGCTACTGATGAATTGATCGCAACTCCAAAGCAAGTAACAGTGATCATTGTTAACGAATTGGCTCTTACTCCACTATTGGGCGTTCACTGCAGATCCAAGGAAGACGATTTAGGAGTCCATATTATAGAGGCAGATAAAAGCTACTCTTTTACCTTTAAAACCAACGTCTGGGAGACCACACTATTTTACTGTAGTTTCGAATGGGTGAAAGGTGAAATCCACCAGTTTACGATTTATGACTACAAAAGAGATAATCCAAAAGGTTGCGCCAGTTGCAGATGGCTCATTTATACAAGTGGGCCCTGTTATCAACACATAGACTCTCCATCTCTTACGTGCTATCCTTGGGACAAGACCAGCACTCTCAAA TTGTTGTTGTTGTTACCCGTTAGCCTACATGCTACTGATGAATTGATCGCAACTCCAAAGCAAGTAACAGTGATCATTGTTAACGAATTGGCTCTTACTCCACTATTGGGCGTTCACTGCAGATCCAAGGAAGACGATTTAGGAGTCCATATTATAGAGGCAGATAAAAGCTACTCTTTTACCTTTAAAACCAACGTCTGGGAGACCACACTATTTTACTGTAGTTTCGAATGGGTGAAAGGTGAAATCCACCAGTTTACGATTTATGACTACAAAAGAGATAATCCAAAAGGTTGCGCCAGTTGCAGATGGCTCATTTATACAAGTGGGCCCTGTTATCAACACATAGACTCTCCATCTCTTACGTGCTATCCTTGGGACAAGACCAGCACTCTCAAA TTGTTGTTGTTGTTACCCGTTAGCCTACATGCTACTGATGAATTGATCGCAACTCCAAAGCAAGTAACAGTGATCATTGTTAACGAATTGGCTCTTACTCCACTATTGGGCGTTCACTGCAGATCCAAGGAAGACGATTTAGGAGTCCATATTATAGAGGCAGATAAAAGCTACTCTTTTACCTTTAAAACCAACGTCTGGGAGACCACACTATTTTACTGTAGTTTCGAATGGGTGAAAGGTGAAATCCACCAGTTTACGATTTATGACTACAAAAGAGATAATCCAAAAGGTTGCGCCAGTTGCAGATGGCTCATTTATACAAGTGGGCCCTGTTATCAACACATAGACTCTCCATCTCTTACGTGCTATCCTTGGGACAAGACCAGCACTCTCAAA LLLLLPVSLHATDELIATPKQVTVIIVNELALTPLLGVHCRSKEDDLGVHIIEADKSYSFTFKTNVWETTLFYCSFEWVKGEIHQFTIYDYKRDNPKGCASCRWLIYTSGPCYQHIDSPSLTCYPWDKTSTLK Homology
BLAST of MS007785 vs. NCBI nr
Match: ABY56091.1 (self-incompatibility protein 1 [Cucumis melo] >ABY56095.1 self-incompatibility protein 3 [Cucumis melo] >ABY56096.1 self-incompatibility protein 4 [Cucumis melo]) HSP 1 Score: 184.1 bits (466), Expect = 7.8e-43 Identity = 83/130 (63.85%), Postives = 105/130 (80.77%), Query Frame = 0
BLAST of MS007785 vs. NCBI nr
Match: ABY56092.1 (self-incompatibility protein 2 [Cucumis melo]) HSP 1 Score: 184.1 bits (466), Expect = 7.8e-43 Identity = 83/130 (63.85%), Postives = 105/130 (80.77%), Query Frame = 0
BLAST of MS007785 vs. NCBI nr
Match: KAA0046095.1 (self-incompatibility protein 1 [Cucumis melo var. makuwa]) HSP 1 Score: 176.8 bits (447), Expect = 1.2e-40 Identity = 82/130 (63.08%), Postives = 100/130 (76.92%), Query Frame = 0
BLAST of MS007785 vs. NCBI nr
Match: KAA0046284.1 (self-incompatibility protein 1 [Cucumis melo var. makuwa]) HSP 1 Score: 164.9 bits (416), Expect = 4.9e-37 Identity = 72/118 (61.02%), Postives = 94/118 (79.66%), Query Frame = 0
BLAST of MS007785 vs. NCBI nr
Match: EEF44294.1 (conserved hypothetical protein [Ricinus communis]) HSP 1 Score: 110.5 bits (275), Expect = 1.1e-20 Identity = 51/110 (46.36%), Postives = 67/110 (60.91%), Query Frame = 0
BLAST of MS007785 vs. ExPASy Swiss-Prot
Match: O23020 (S-protein homolog 5 OS=Arabidopsis thaliana OX=3702 GN=SPH5 PE=2 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 1.1e-18 Identity = 42/106 (39.62%), Postives = 62/106 (58.49%), Query Frame = 0
BLAST of MS007785 vs. ExPASy Swiss-Prot
Match: Q9FMQ4 (S-protein homolog 3 OS=Arabidopsis thaliana OX=3702 GN=SPH3 PE=2 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 1.9e-15 Identity = 49/131 (37.40%), Postives = 68/131 (51.91%), Query Frame = 0
BLAST of MS007785 vs. ExPASy Swiss-Prot
Match: F4JLQ5 (S-protein homolog 2 OS=Arabidopsis thaliana OX=3702 GN=SPH2 PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 1.6e-14 Identity = 48/130 (36.92%), Postives = 71/130 (54.62%), Query Frame = 0
BLAST of MS007785 vs. ExPASy Swiss-Prot
Match: F4JZG1 (S-protein homolog 4 OS=Arabidopsis thaliana OX=3702 GN=SPH4 PE=3 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 1.5e-12 Identity = 42/109 (38.53%), Postives = 57/109 (52.29%), Query Frame = 0
BLAST of MS007785 vs. ExPASy Swiss-Prot
Match: B3H730 (S-protein homolog 18 OS=Arabidopsis thaliana OX=3702 GN=SPH18 PE=3 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 7.4e-12 Identity = 38/95 (40.00%), Postives = 51/95 (53.68%), Query Frame = 0
BLAST of MS007785 vs. ExPASy TrEMBL
Match: B0F817 (S-protein homolog OS=Cucumis melo OX=3656 PE=3 SV=1) HSP 1 Score: 184.1 bits (466), Expect = 3.8e-43 Identity = 83/130 (63.85%), Postives = 105/130 (80.77%), Query Frame = 0
BLAST of MS007785 vs. ExPASy TrEMBL
Match: B0F818 (S-protein homolog OS=Cucumis melo OX=3656 PE=3 SV=1) HSP 1 Score: 184.1 bits (466), Expect = 3.8e-43 Identity = 83/130 (63.85%), Postives = 105/130 (80.77%), Query Frame = 0
BLAST of MS007785 vs. ExPASy TrEMBL
Match: A0A5A7TXE8 (S-protein homolog OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold157G00180 PE=3 SV=1) HSP 1 Score: 176.8 bits (447), Expect = 6.0e-41 Identity = 82/130 (63.08%), Postives = 100/130 (76.92%), Query Frame = 0
BLAST of MS007785 vs. ExPASy TrEMBL
Match: A0A5A7TT98 (S-protein homolog OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold384G00010 PE=3 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 2.4e-37 Identity = 72/118 (61.02%), Postives = 94/118 (79.66%), Query Frame = 0
BLAST of MS007785 vs. ExPASy TrEMBL
Match: B9RWP2 (S-protein homolog OS=Ricinus communis OX=3988 GN=RCOM_1023130 PE=3 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 5.3e-21 Identity = 51/110 (46.36%), Postives = 67/110 (60.91%), Query Frame = 0
BLAST of MS007785 vs. TAIR 10
Match: AT1G04645.1 (Plant self-incompatibility protein S1 family ) HSP 1 Score: 94.4 bits (233), Expect = 7.6e-20 Identity = 42/106 (39.62%), Postives = 62/106 (58.49%), Query Frame = 0
BLAST of MS007785 vs. TAIR 10
Match: AT1G26796.1 (Plant self-incompatibility protein S1 family ) HSP 1 Score: 85.1 bits (209), Expect = 4.6e-17 Identity = 47/117 (40.17%), Postives = 63/117 (53.85%), Query Frame = 0
BLAST of MS007785 vs. TAIR 10
Match: AT1G26799.1 (Plant self-incompatibility protein S1 family ) HSP 1 Score: 84.0 bits (206), Expect = 1.0e-16 Identity = 45/119 (37.82%), Postives = 63/119 (52.94%), Query Frame = 0
BLAST of MS007785 vs. TAIR 10
Match: AT5G12060.1 (Plant self-incompatibility protein S1 family ) HSP 1 Score: 83.6 bits (205), Expect = 1.3e-16 Identity = 49/131 (37.40%), Postives = 68/131 (51.91%), Query Frame = 0
BLAST of MS007785 vs. TAIR 10
Match: AT3G16970.1 (Plant self-incompatibility protein S1 family ) HSP 1 Score: 82.8 bits (203), Expect = 2.3e-16 Identity = 45/114 (39.47%), Postives = 61/114 (53.51%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
|