
MS006743 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAATTGTTTTCTGCTCCTCTGTTTTTGGTTGTGCTGCTTCCAGCAATGGTGGCGGCTGCAGCTGCAGCCGCGCCGTCCCCTAGTCCACTCGGCGGTTATGTGACGATCAAAGATGTGAATGCCTCGTTCATTCAAGAAATCGGAAGGTATGCATGTATTGAATACAACAGGATAAATCAGAAAGAACCTAAGTTTACACCACATGTATACCAGAAAGTGGTGAAGGGGGAACAACAGGTGGTGGCTGGAATGAACTACAAGCTCGAATTAATGGTCACAGTCAACAAACAAAGTCAATATTATCAGGCCATCGTGTATGACAGGTCGTGGGAGAGCCACAGAGAACTTACATCTTTCCATCTCCTCTTA ATGAAATTGTTTTCTGCTCCTCTGTTTTTGGTTGTGCTGCTTCCAGCAATGGTGGCGGCTGCAGCTGCAGCCGCGCCGTCCCCTAGTCCACTCGGCGGTTATGTGACGATCAAAGATGTGAATGCCTCGTTCATTCAAGAAATCGGAAGGTATGCATGTATTGAATACAACAGGATAAATCAGAAAGAACCTAAGTTTACACCACATGTATACCAGAAAGTGGTGAAGGGGGAACAACAGGTGGTGGCTGGAATGAACTACAAGCTCGAATTAATGGTCACAGTCAACAAACAAAGTCAATATTATCAGGCCATCGTGTATGACAGGTCGTGGGAGAGCCACAGAGAACTTACATCTTTCCATCTCCTCTTA ATGAAATTGTTTTCTGCTCCTCTGTTTTTGGTTGTGCTGCTTCCAGCAATGGTGGCGGCTGCAGCTGCAGCCGCGCCGTCCCCTAGTCCACTCGGCGGTTATGTGACGATCAAAGATGTGAATGCCTCGTTCATTCAAGAAATCGGAAGGTATGCATGTATTGAATACAACAGGATAAATCAGAAAGAACCTAAGTTTACACCACATGTATACCAGAAAGTGGTGAAGGGGGAACAACAGGTGGTGGCTGGAATGAACTACAAGCTCGAATTAATGGTCACAGTCAACAAACAAAGTCAATATTATCAGGCCATCGTGTATGACAGGTCGTGGGAGAGCCACAGAGAACTTACATCTTTCCATCTCCTCTTA MKLFSAPLFLVVLLPAMVAAAAAAAPSPSPLGGYVTIKDVNASFIQEIGRYACIEYNRINQKEPKFTPHVYQKVVKGEQQVVAGMNYKLELMVTVNKQSQYYQAIVYDRSWESHRELTSFHLLL Homology
BLAST of MS006743 vs. NCBI nr
Match: XP_022156942.1 (cysteine proteinase inhibitor 1-like [Momordica charantia]) HSP 1 Score: 177.6 bits (449), Expect = 6.8e-41 Identity = 90/108 (83.33%), Postives = 94/108 (87.04%), Query Frame = 0
BLAST of MS006743 vs. NCBI nr
Match: XP_022156941.1 (cysteine proteinase inhibitor 5-like [Momordica charantia]) HSP 1 Score: 140.6 bits (353), Expect = 9.2e-30 Identity = 69/103 (66.99%), Postives = 80/103 (77.67%), Query Frame = 0
BLAST of MS006743 vs. NCBI nr
Match: XP_022147176.1 (cysteine proteinase inhibitor 1-like [Momordica charantia]) HSP 1 Score: 125.2 bits (313), Expect = 4.0e-25 Identity = 66/104 (63.46%), Postives = 79/104 (75.96%), Query Frame = 0
BLAST of MS006743 vs. NCBI nr
Match: XP_022156944.1 (cysteine proteinase inhibitor 5-like [Momordica charantia]) HSP 1 Score: 124.4 bits (311), Expect = 6.8e-25 Identity = 75/128 (58.59%), Postives = 88/128 (68.75%), Query Frame = 0
BLAST of MS006743 vs. NCBI nr
Match: KAF3451836.1 (hypothetical protein FNV43_RR07932 [Rhamnella rubrinervis]) HSP 1 Score: 83.2 bits (204), Expect = 1.7e-12 Identity = 48/112 (42.86%), Postives = 74/112 (66.07%), Query Frame = 0
BLAST of MS006743 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 62.4 bits (150), Expect = 4.2e-09 Identity = 39/114 (34.21%), Postives = 64/114 (56.14%), Query Frame = 0
BLAST of MS006743 vs. ExPASy Swiss-Prot
Match: Q10Q46 (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 4.2e-09 Identity = 39/106 (36.79%), Postives = 62/106 (58.49%), Query Frame = 0
BLAST of MS006743 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 2.1e-08 Identity = 38/114 (33.33%), Postives = 62/114 (54.39%), Query Frame = 0
BLAST of MS006743 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 60.1 bits (144), Expect = 2.1e-08 Identity = 46/119 (38.66%), Postives = 67/119 (56.30%), Query Frame = 0
BLAST of MS006743 vs. ExPASy Swiss-Prot
Match: Q10J94 (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 2.7e-08 Identity = 45/118 (38.14%), Postives = 66/118 (55.93%), Query Frame = 0
BLAST of MS006743 vs. ExPASy TrEMBL
Match: A0A6J1DTA4 (cysteine proteinase inhibitor 1-like OS=Momordica charantia OX=3673 GN=LOC111023774 PE=4 SV=1) HSP 1 Score: 177.6 bits (449), Expect = 3.3e-41 Identity = 90/108 (83.33%), Postives = 94/108 (87.04%), Query Frame = 0
BLAST of MS006743 vs. ExPASy TrEMBL
Match: A0A6J1DWG9 (cysteine proteinase inhibitor 5-like OS=Momordica charantia OX=3673 GN=LOC111023773 PE=4 SV=1) HSP 1 Score: 140.6 bits (353), Expect = 4.5e-30 Identity = 69/103 (66.99%), Postives = 80/103 (77.67%), Query Frame = 0
BLAST of MS006743 vs. ExPASy TrEMBL
Match: A0A6J1D1J8 (cysteine proteinase inhibitor 1-like OS=Momordica charantia OX=3673 GN=LOC111016188 PE=4 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 1.9e-25 Identity = 66/104 (63.46%), Postives = 79/104 (75.96%), Query Frame = 0
BLAST of MS006743 vs. ExPASy TrEMBL
Match: A0A6J1DV34 (cysteine proteinase inhibitor 5-like OS=Momordica charantia OX=3673 GN=LOC111023777 PE=4 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 3.3e-25 Identity = 75/128 (58.59%), Postives = 88/128 (68.75%), Query Frame = 0
BLAST of MS006743 vs. ExPASy TrEMBL
Match: A0A6J1CMN4 (cysteine proteinase inhibitor 5-like OS=Momordica charantia OX=3673 GN=LOC111012543 PE=4 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 1.4e-12 Identity = 54/121 (44.63%), Postives = 74/121 (61.16%), Query Frame = 0
BLAST of MS006743 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 60.1 bits (144), Expect = 1.5e-09 Identity = 46/119 (38.66%), Postives = 67/119 (56.30%), Query Frame = 0
BLAST of MS006743 vs. TAIR 10
Match: AT2G40880.1 (cystatin A ) HSP 1 Score: 44.7 bits (104), Expect = 6.4e-05 Identity = 28/91 (30.77%), Postives = 50/91 (54.95%), Query Frame = 0
BLAST of MS006743 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 40.8 bits (94), Expect = 9.3e-04 Identity = 24/80 (30.00%), Postives = 43/80 (53.75%), Query Frame = 0
BLAST of MS006743 vs. TAIR 10
Match: AT3G12490.1 (cystatin B ) HSP 1 Score: 40.8 bits (94), Expect = 9.3e-04 Identity = 24/80 (30.00%), Postives = 43/80 (53.75%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|