MS005436 (gene) Bitter gourd (TR) v1
|
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GATTCTGAAATTGCGGAGGCTTGGTTCAATCAAGCTGCTGAGTATTGGAAACAAGCTATAGCACTTACTCCCGGTAATTATATTGAAGCACAAAATTGGTTGAAGATCACAAGGCGTTTCAAAGATTCTGAAATTGCGGAGGCTTGGTTCAATCAAGCTGCTGAGTATTGGAAACAAGCTATAGCACTTACTCCCGGTAATTATATTGAAGCACAAAATTGGTTGAAGATCACAAGGCGTTTCAAA GATTCTGAAATTGCGGAGGCTTGGTTCAATCAAGCTGCTGAGTATTGGAAACAAGCTATAGCACTTACTCCCGGTAATTATATTGAAGCACAAAATTGGTTGAAGATCACAAGGCGTTTCAAA DSEIAEAWFNQAAEYWKQAIALTPGNYIEAQNWLKITRRFK Homology
BLAST of MS005436 vs. NCBI nr
Match: YP_009525187.1 (photosystem I assembly protein Ycf3 [Hodgsonia macrocarpa] >YP_009560836.1 Ycf3 [Trichosanthes kirilowii] >YP_009751654.1 photosystem I assembly protein Ycf3 [Hodgsonia heteroclita] >YP_009751991.1 photosystem I assembly protein Ycf3 [Cionosicys macranthus] >YP_009752160.1 photosystem I assembly protein Ycf3 [Linnaeosicyos amara] >YP_009752244.1 photosystem I assembly protein Ycf3 [Trichosanthes baviensis] >YP_009752413.1 photosystem I assembly protein Ycf3 [Trichosanthes tricuspidata] >YP_009752497.1 photosystem I assembly protein Ycf3 [Trichosanthes tubiflora] >YP_009752582.1 photosystem I assembly protein Ycf3 [Trichosanthes homophylla] >YP_009752667.1 photosystem I assembly protein Ycf3 [Ampelosycios humblotii] >YP_009752921.1 photosystem I assembly protein Ycf3 [Momordica sessilifolia] >YP_009753175.1 photosystem I assembly protein Ycf3 [Trichosanthes truncata] >YP_009753259.1 photosystem I assembly protein Ycf3 [Nothoalsomitra suberosa] >YP_009753621.1 photosystem I assembly protein Ycf3 [Trichosanthes wallichiana] >YP_009753706.1 photosystem I assembly protein Ycf3 [Trichosanthes nervifolia] >YP_009753790.1 photosystem I assembly protein Ycf3 [Trichosanthes pilosa] >YP_009753875.1 photosystem I assembly protein Ycf3 [Trichosanthes lobata] >QIT04051.1 photosystem I assembly protein Ycf3 [Luffa aegyptiaca] >QKX48474.1 photosystem I assembly protein Ycf3 [Luffa acutangula] >AXR94588.1 photosystem I assembly protein Ycf3 [Hodgsonia macrocarpa] >AXR94674.1 photosystem I assembly protein Ycf3 [Hodgsonia macrocarpa] >AXR94757.1 photosystem I assembly protein Ycf3 [Hodgsonia macrocarpa]) HSP 1 Score: 90.5 bits (223), Expect = 3.6e-15 Identity = 41/41 (100.00%), Postives = 41/41 (100.00%), Query Frame = 0
BLAST of MS005436 vs. NCBI nr
Match: YP_009447451.1 (photosystem I assembly protein Ycf3 [Cucurbita maxima] >YP_009447536.1 photosystem I assembly protein Ycf3 [Cucurbita moschata] >YP_009456062.1 photosystem I assembly protein Ycf3 [Momordica charantia] >QWV60841.1 photosystem I assembly protein Ycf3 [Cucurbita ficifolia] >ATY69920.1 photosystem I assembly protein Ycf3 [Cucurbita maxima] >ATY70001.1 photosystem I assembly protein Ycf3 [Cucurbita moschata] >AUJ21829.1 photosystem I assembly protein Ycf3 [Momordica charantia]) HSP 1 Score: 90.5 bits (223), Expect = 3.6e-15 Identity = 41/41 (100.00%), Postives = 41/41 (100.00%), Query Frame = 0
BLAST of MS005436 vs. NCBI nr
Match: QJD26297.1 (Ycf3 [Trichosanthes kirilowii] >QJD26472.1 Ycf3 [Trichosanthes kirilowii var. japonica] >QJD26646.1 Ycf3 [Trichosanthes rosthornii] >QKX48560.1 photosystem I assembly protein Ycf3 [Luffa aegyptiaca] >QJD26384.1 Ycf3 [Trichosanthes kirilowii]) HSP 1 Score: 90.5 bits (223), Expect = 3.6e-15 Identity = 41/41 (100.00%), Postives = 41/41 (100.00%), Query Frame = 0
BLAST of MS005436 vs. NCBI nr
Match: QJR52957.1 (photosystem I assembly protein Ycf3 [Herpetospermum pedunculosum]) HSP 1 Score: 90.5 bits (223), Expect = 3.6e-15 Identity = 41/41 (100.00%), Postives = 41/41 (100.00%), Query Frame = 0
BLAST of MS005436 vs. NCBI nr
Match: YP_009751823.1 (photosystem I assembly protein Ycf3 [Indofevillea khasiana] >QIT04556.1 photosystem I assembly protein Ycf3 [Indofevillea khasiana] >QJS52321.1 photosystem I assembly protein Ycf3 [Indofevillea khasiana]) HSP 1 Score: 90.5 bits (223), Expect = 3.6e-15 Identity = 41/41 (100.00%), Postives = 41/41 (100.00%), Query Frame = 0
BLAST of MS005436 vs. ExPASy Swiss-Prot
Match: Q4VZH4 (Photosystem I assembly protein Ycf3 OS=Cucumis sativus OX=3659 GN=ycf3 PE=3 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 4.7e-18 Identity = 41/41 (100.00%), Postives = 41/41 (100.00%), Query Frame = 0
BLAST of MS005436 vs. ExPASy Swiss-Prot
Match: Q49KZ7 (Photosystem I assembly protein Ycf3 OS=Eucalyptus globulus subsp. globulus OX=71271 GN=ycf3 PE=3 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 5.3e-17 Identity = 39/41 (95.12%), Postives = 41/41 (100.00%), Query Frame = 0
BLAST of MS005436 vs. ExPASy Swiss-Prot
Match: A0ZZ36 (Photosystem I assembly protein Ycf3 OS=Gossypium barbadense OX=3634 GN=ycf3 PE=3 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 5.3e-17 Identity = 39/41 (95.12%), Postives = 41/41 (100.00%), Query Frame = 0
BLAST of MS005436 vs. ExPASy Swiss-Prot
Match: Q2L906 (Photosystem I assembly protein Ycf3 OS=Gossypium hirsutum OX=3635 GN=ycf3 PE=3 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 5.3e-17 Identity = 39/41 (95.12%), Postives = 41/41 (100.00%), Query Frame = 0
BLAST of MS005436 vs. ExPASy Swiss-Prot
Match: Q9MTP0 (Photosystem I assembly protein Ycf3 OS=Oenothera elata subsp. hookeri OX=85636 GN=ycf3 PE=3 SV=3) HSP 1 Score: 87.0 bits (214), Expect = 5.3e-17 Identity = 39/41 (95.12%), Postives = 41/41 (100.00%), Query Frame = 0
BLAST of MS005436 vs. ExPASy TrEMBL
Match: A0A218KG30 (Photosystem I assembly protein Ycf3 OS=Cucumis sativus var. hardwickii OX=319220 GN=ycf3 PE=3 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.8e-15 Identity = 41/41 (100.00%), Postives = 41/41 (100.00%), Query Frame = 0
BLAST of MS005436 vs. ExPASy TrEMBL
Match: A0A6M3S6C6 (Photosystem I assembly protein Ycf3 OS=Trichosanthes kirilowii OX=3677 GN=ycf3 PE=3 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.8e-15 Identity = 41/41 (100.00%), Postives = 41/41 (100.00%), Query Frame = 0
BLAST of MS005436 vs. ExPASy TrEMBL
Match: A0A410HF83 (Photosystem I assembly protein Ycf3 OS=Trichosanthes kirilowii OX=3677 GN=ycf3 PE=3 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.8e-15 Identity = 41/41 (100.00%), Postives = 41/41 (100.00%), Query Frame = 0
BLAST of MS005436 vs. ExPASy TrEMBL
Match: G3ETY6 (Photosystem I assembly protein Ycf3 OS=Cucumis melo subsp. melo OX=412675 GN=ycf3 PE=3 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.8e-15 Identity = 41/41 (100.00%), Postives = 41/41 (100.00%), Query Frame = 0
BLAST of MS005436 vs. ExPASy TrEMBL
Match: A0A1X9Q1C0 (Photosystem I assembly protein ycf3 OS=Cucumis sativus OX=3659 GN=ycf3 PE=4 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.8e-15 Identity = 41/41 (100.00%), Postives = 41/41 (100.00%), Query Frame = 0
BLAST of MS005436 vs. TAIR 10
Match: ATCG00360.1 (Tetratricopeptide repeat (TPR)-like superfamily protein ) HSP 1 Score: 80.9 bits (198), Expect = 2.7e-16 Identity = 36/41 (87.80%), Postives = 38/41 (92.68%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
|