MS001346 (gene) Bitter gourd (TR) v1
|
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.CAGCCGTCTCACAAGACCTTCAGGATTAAGAAGAAGTTGGCGAAAAAGATGCGACAGAACAGGCCTATTCCTCACTGGATTCGCCTGAGGACCGACAATACCATCAGGTCTTTACTCTTCCTTTCTATTTTCCTTCGTATTATCATCTCCGTACTTCTAAGTTTTGATTCTAAAGCTGCATTTTGATGTGTTCTTCAGGTATAATGCGAAGCGAAGGCACTGGCGCCGCACTAAGCTCGGATTTCAGCCGTCTCACAAGACCTTCAGGATTAAGAAGAAGTTGGCGAAAAAGATGCGACAGAACAGGCCTATTCCTCACTGGATTCGCCTGAGGACCGACAATACCATCAGGTATAATGCGAAGCGAAGGCACTGGCGCCGCACTAAGCTCGGATTT CAGCCGTCTCACAAGACCTTCAGGATTAAGAAGAAGTTGGCGAAAAAGATGCGACAGAACAGGCCTATTCCTCACTGGATTCGCCTGAGGACCGACAATACCATCAGGTATAATGCGAAGCGAAGGCACTGGCGCCGCACTAAGCTCGGATTT QPSHKTFRIKKKLAKKMRQNRPIPHWIRLRTDNTIRYNAKRRHWRRTKLGF Homology
BLAST of MS001346 vs. NCBI nr
Match: EXB38641.1 (60S ribosomal protein L39 [Morus notabilis]) HSP 1 Score: 108.2 bits (269), Expect = 2.1e-20 Identity = 51/51 (100.00%), Postives = 51/51 (100.00%), Query Frame = 0
BLAST of MS001346 vs. NCBI nr
Match: KAA0050937.1 (60S ribosomal protein L39 [Cucumis melo var. makuwa] >KAG7022407.1 60S ribosomal protein L39, partial [Cucurbita argyrosperma subsp. argyrosperma] >TYK10284.1 60S ribosomal protein L39 [Cucumis melo var. makuwa]) HSP 1 Score: 108.2 bits (269), Expect = 2.1e-20 Identity = 51/51 (100.00%), Postives = 51/51 (100.00%), Query Frame = 0
BLAST of MS001346 vs. NCBI nr
Match: PKI64675.1 (hypothetical protein CRG98_014891 [Punica granatum]) HSP 1 Score: 107.5 bits (267), Expect = 3.6e-20 Identity = 50/51 (98.04%), Postives = 51/51 (100.00%), Query Frame = 0
BLAST of MS001346 vs. NCBI nr
Match: OWM65802.1 (hypothetical protein CDL15_Pgr015227 [Punica granatum]) HSP 1 Score: 107.5 bits (267), Expect = 3.6e-20 Identity = 50/51 (98.04%), Postives = 51/51 (100.00%), Query Frame = 0
BLAST of MS001346 vs. NCBI nr
Match: XP_022962571.1 (uncharacterized protein LOC111462968 [Cucurbita moschata]) HSP 1 Score: 106.7 bits (265), Expect = 6.1e-20 Identity = 50/50 (100.00%), Postives = 50/50 (100.00%), Query Frame = 0
BLAST of MS001346 vs. ExPASy Swiss-Prot
Match: Q6KAJ8 (60S ribosomal protein L39-1 OS=Oryza sativa subsp. japonica OX=39947 GN=RPL39A PE=3 SV=2) HSP 1 Score: 103.6 bits (257), Expect = 6.7e-22 Identity = 48/50 (96.00%), Postives = 50/50 (100.00%), Query Frame = 0
BLAST of MS001346 vs. ExPASy Swiss-Prot
Match: P51426 (60S ribosomal protein L39-2 OS=Oryza sativa subsp. japonica OX=39947 GN=RPL39B PE=3 SV=2) HSP 1 Score: 103.6 bits (257), Expect = 6.7e-22 Identity = 48/50 (96.00%), Postives = 50/50 (100.00%), Query Frame = 0
BLAST of MS001346 vs. ExPASy Swiss-Prot
Match: P51425 (60S ribosomal protein L39 OS=Zea mays OX=4577 GN=RPL39 PE=3 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 6.7e-22 Identity = 48/50 (96.00%), Postives = 50/50 (100.00%), Query Frame = 0
BLAST of MS001346 vs. ExPASy Swiss-Prot
Match: Q5SMI4 (60S ribosomal protein L39-3 OS=Oryza sativa subsp. japonica OX=39947 GN=RPL39C PE=3 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 2.0e-21 Identity = 47/50 (94.00%), Postives = 50/50 (100.00%), Query Frame = 0
BLAST of MS001346 vs. ExPASy Swiss-Prot
Match: P51424 (60S ribosomal protein L39-1 OS=Arabidopsis thaliana OX=3702 GN=RPL39A PE=3 SV=2) HSP 1 Score: 101.3 bits (251), Expect = 3.3e-21 Identity = 47/50 (94.00%), Postives = 48/50 (96.00%), Query Frame = 0
BLAST of MS001346 vs. ExPASy TrEMBL
Match: A0A5A7U961 (60S ribosomal protein L39 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold16G004350 PE=3 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 1.0e-20 Identity = 51/51 (100.00%), Postives = 51/51 (100.00%), Query Frame = 0
BLAST of MS001346 vs. ExPASy TrEMBL
Match: W9R5P2 (60S ribosomal protein L39 OS=Morus notabilis OX=981085 GN=L484_014456 PE=3 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 1.0e-20 Identity = 51/51 (100.00%), Postives = 51/51 (100.00%), Query Frame = 0
BLAST of MS001346 vs. ExPASy TrEMBL
Match: A0A218W104 (Uncharacterized protein OS=Punica granatum OX=22663 GN=CDL15_Pgr015227 PE=3 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 1.7e-20 Identity = 50/51 (98.04%), Postives = 51/51 (100.00%), Query Frame = 0
BLAST of MS001346 vs. ExPASy TrEMBL
Match: A0A2I0K803 (Uncharacterized protein OS=Punica granatum OX=22663 GN=CRG98_014891 PE=3 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 1.7e-20 Identity = 50/51 (98.04%), Postives = 51/51 (100.00%), Query Frame = 0
BLAST of MS001346 vs. ExPASy TrEMBL
Match: A0A6J1HZ80 (60S ribosomal protein L39 OS=Cucurbita maxima OX=3661 GN=LOC111467947 PE=3 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 2.9e-20 Identity = 50/50 (100.00%), Postives = 50/50 (100.00%), Query Frame = 0
BLAST of MS001346 vs. TAIR 10
Match: AT4G31985.1 (Ribosomal protein L39 family protein ) HSP 1 Score: 101.3 bits (251), Expect = 2.4e-22 Identity = 47/50 (94.00%), Postives = 48/50 (96.00%), Query Frame = 0
BLAST of MS001346 vs. TAIR 10
Match: AT3G02190.1 (Ribosomal protein L39 family protein ) HSP 1 Score: 96.3 bits (238), Expect = 7.6e-21 Identity = 45/50 (90.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of MS001346 vs. TAIR 10
Match: AT2G25210.1 (Ribosomal protein L39 family protein ) HSP 1 Score: 90.1 bits (222), Expect = 5.5e-19 Identity = 42/43 (97.67%), Postives = 42/43 (97.67%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|