MELO3C034667.jh1 (gene) Melon (Harukei-3) v1.41
Overview
Sequences
The following sequences are available for this feature:
Legend: exonstart_codonCDSpolypeptidestop_codon Hold the cursor over a type above to highlight its positions in the sequence below.ATGCAAGGAACATGCGCAAGGCAGTCGCATACAAGGGAAGAGGTAGAGACATACGAAGAAGATGAAGACGAGCACGGTGACACCTTATGTAGGGCATGCGGTGAGAACTATGCTTCAGATGAATTTTGGATTTGCTGTGATATCTATGAGAAATGGTTCCATGGGAAGTTTGTTGTATGA ATGCAAGGAACATGCGCAAGGCAGTCGCATACAAGGGAAGAGGTAGAGACATACGAAGAAGATGAAGACGAGCACGGTGACACCTTATGTAGGGCATGCGGTGAGAACTATGCTTCAGATGAATTTTGGATTTGCTGTGATATCTATGAGAAATGGTTCCATGGGAAGTTTGTTGTATGA ATGCAAGGAACATGCGCAAGGCAGTCGCATACAAGGGAAGAGGTAGAGACATACGAAGAAGATGAAGACGAGCACGGTGACACCTTATGTAGGGCATGCGGTGAGAACTATGCTTCAGATGAATTTTGGATTTGCTGTGATATCTATGAGAAATGGTTCCATGGGAAGTTTGTTGTATGA MQGTCARQSHTREEVETYEEDEDEHGDTLCRACGENYASDEFWICCDIYEKWFHGKFVV Homology
BLAST of MELO3C034667.jh1 vs. NCBI nr
Match: TYK29017.1 (PHD finger protein ALFIN-LIKE 3-like [Cucumis melo var. makuwa]) HSP 1 Score: 124 bits (312), Expect = 6.37e-36 Identity = 55/59 (93.22%), Postives = 55/59 (93.22%), Query Frame = 0
BLAST of MELO3C034667.jh1 vs. NCBI nr
Match: XP_016903323.1 (PREDICTED: PHD finger protein ALFIN-LIKE 3-like [Cucumis melo]) HSP 1 Score: 121 bits (303), Expect = 4.40e-34 Identity = 53/59 (89.83%), Postives = 55/59 (93.22%), Query Frame = 0
BLAST of MELO3C034667.jh1 vs. NCBI nr
Match: KAA0067842.1 (PHD finger protein ALFIN-LIKE 3-like [Cucumis melo var. makuwa]) HSP 1 Score: 121 bits (303), Expect = 1.27e-33 Identity = 53/59 (89.83%), Postives = 55/59 (93.22%), Query Frame = 0
BLAST of MELO3C034667.jh1 vs. NCBI nr
Match: TYJ98373.1 (PHD finger protein ALFIN-LIKE 3-like isoform X2 [Cucumis melo var. makuwa]) HSP 1 Score: 120 bits (301), Expect = 3.39e-32 Identity = 53/53 (100.00%), Postives = 53/53 (100.00%), Query Frame = 0
BLAST of MELO3C034667.jh1 vs. NCBI nr
Match: KAA0032497.1 (PHD finger protein ALFIN-LIKE 3-like isoform X2 [Cucumis melo var. makuwa]) HSP 1 Score: 117 bits (293), Expect = 4.02e-31 Identity = 52/53 (98.11%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MELO3C034667.jh1 vs. ExPASy Swiss-Prot
Match: Q5XEM9 (PHD finger protein ALFIN-LIKE 5 OS=Arabidopsis thaliana OX=3702 GN=AL5 PE=2 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 5.4e-15 Identity = 34/46 (73.91%), Postives = 39/46 (84.78%), Query Frame = 0
BLAST of MELO3C034667.jh1 vs. ExPASy Swiss-Prot
Match: Q9FFF5 (PHD finger protein ALFIN-LIKE 1 OS=Arabidopsis thaliana OX=3702 GN=AL1 PE=1 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 2.7e-14 Identity = 29/43 (67.44%), Postives = 38/43 (88.37%), Query Frame = 0
BLAST of MELO3C034667.jh1 vs. ExPASy Swiss-Prot
Match: Q9M2B4 (PHD finger protein ALFIN-LIKE 3 OS=Arabidopsis thaliana OX=3702 GN=AL3 PE=1 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 5.1e-13 Identity = 32/58 (55.17%), Postives = 43/58 (74.14%), Query Frame = 0
BLAST of MELO3C034667.jh1 vs. ExPASy Swiss-Prot
Match: O81488 (PHD finger protein ALFIN-LIKE 4 OS=Arabidopsis thaliana OX=3702 GN=AL4 PE=1 SV=2) HSP 1 Score: 74.3 bits (181), Expect = 5.1e-13 Identity = 32/52 (61.54%), Postives = 37/52 (71.15%), Query Frame = 0
BLAST of MELO3C034667.jh1 vs. ExPASy Swiss-Prot
Match: B8B8C5 (PHD finger protein ALFIN-LIKE 9 OS=Oryza sativa subsp. indica OX=39946 GN=OsI_26819 PE=3 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 5.1e-13 Identity = 29/37 (78.38%), Postives = 33/37 (89.19%), Query Frame = 0
BLAST of MELO3C034667.jh1 vs. ExPASy TrEMBL
Match: A0A5D3DYQ4 (PHD finger protein ALFIN-LIKE 3-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold120G001280 PE=4 SV=1) HSP 1 Score: 124 bits (312), Expect = 3.08e-36 Identity = 55/59 (93.22%), Postives = 55/59 (93.22%), Query Frame = 0
BLAST of MELO3C034667.jh1 vs. ExPASy TrEMBL
Match: A0A1S4E514 (PHD finger protein ALFIN-LIKE 3-like OS=Cucumis melo OX=3656 GN=LOC107992128 PE=4 SV=1) HSP 1 Score: 121 bits (303), Expect = 2.13e-34 Identity = 53/59 (89.83%), Postives = 55/59 (93.22%), Query Frame = 0
BLAST of MELO3C034667.jh1 vs. ExPASy TrEMBL
Match: A0A5A7VHJ0 (PHD finger protein ALFIN-LIKE 3-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold2484G00500 PE=4 SV=1) HSP 1 Score: 121 bits (303), Expect = 6.17e-34 Identity = 53/59 (89.83%), Postives = 55/59 (93.22%), Query Frame = 0
BLAST of MELO3C034667.jh1 vs. ExPASy TrEMBL
Match: A0A5D3BGJ5 (PHD finger protein ALFIN-LIKE 3-like isoform X2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold232G001100 PE=4 SV=1) HSP 1 Score: 120 bits (301), Expect = 1.64e-32 Identity = 53/53 (100.00%), Postives = 53/53 (100.00%), Query Frame = 0
BLAST of MELO3C034667.jh1 vs. ExPASy TrEMBL
Match: A0A5A7ST15 (PHD finger protein ALFIN-LIKE 3-like isoform X2 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold465G00040 PE=4 SV=1) HSP 1 Score: 117 bits (293), Expect = 1.95e-31 Identity = 52/53 (98.11%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MELO3C034667.jh1 vs. TAIR 10
Match: AT5G20510.1 (alfin-like 5 ) HSP 1 Score: 80.9 bits (198), Expect = 3.8e-16 Identity = 34/46 (73.91%), Postives = 39/46 (84.78%), Query Frame = 0
BLAST of MELO3C034667.jh1 vs. TAIR 10
Match: AT5G05610.1 (alfin-like 1 ) HSP 1 Score: 78.6 bits (192), Expect = 1.9e-15 Identity = 29/43 (67.44%), Postives = 38/43 (88.37%), Query Frame = 0
BLAST of MELO3C034667.jh1 vs. TAIR 10
Match: AT5G05610.2 (alfin-like 1 ) HSP 1 Score: 78.6 bits (192), Expect = 1.9e-15 Identity = 29/43 (67.44%), Postives = 38/43 (88.37%), Query Frame = 0
BLAST of MELO3C034667.jh1 vs. TAIR 10
Match: AT3G42790.1 (alfin-like 3 ) HSP 1 Score: 74.3 bits (181), Expect = 3.6e-14 Identity = 32/58 (55.17%), Postives = 43/58 (74.14%), Query Frame = 0
BLAST of MELO3C034667.jh1 vs. TAIR 10
Match: AT5G26210.1 (alfin-like 4 ) HSP 1 Score: 74.3 bits (181), Expect = 3.6e-14 Identity = 32/52 (61.54%), Postives = 37/52 (71.15%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Harukei-3) v1.41
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|