
MELO3C034520 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCAGGCAAGGACTCACTTCGCAAGGCCGGAGTGGAAGGAGGTGTTTGGACGAATTGCGTCGAAGCATGCATACAAGACAGTGGGAGTGTTCTATTGTGGAATGCCAATGCTGGCCAAACAACTCAGCACACTGTCACAGCAGTTTACTCTCAAGACTACAACTAGATTTGAGTTCCATAAGGAATATTTTTGA ATGCAGGCAAGGACTCACTTCGCAAGGCCGGAGTGGAAGGAGGTGTTTGGACGAATTGCGTCGAAGCATGCATACAAGACAGTGGGAGTGTTCTATTGTGGAATGCCAATGCTGGCCAAACAACTCAGCACACTGTCACAGCAGTTTACTCTCAAGACTACAACTAGATTTGAGTTCCATAAGGAATATTTTTGA ATGCAGGCAAGGACTCACTTCGCAAGGCCGGAGTGGAAGGAGGTGTTTGGACGAATTGCGTCGAAGCATGCATACAAGACAGTGGGAGTGTTCTATTGTGGAATGCCAATGCTGGCCAAACAACTCAGCACACTGTCACAGCAGTTTACTCTCAAGACTACAACTAGATTTGAGTTCCATAAGGAATATTTTTGA MQARTHFARPEWKEVFGRIASKHAYKTVGVFYCGMPMLAKQLSTLSQQFTLKTTTRFEFHKEYF Homology
BLAST of MELO3C034520 vs. NCBI nr
Match: XP_011655429.1 (respiratory burst oxidase homolog protein E isoform X1 [Cucumis sativus] >KGN51412.1 hypothetical protein Csa_007977 [Cucumis sativus]) HSP 1 Score: 127.9 bits (320), Expect = 3.2e-26 Identity = 60/63 (95.24%), Postives = 61/63 (96.83%), Query Frame = 0
BLAST of MELO3C034520 vs. NCBI nr
Match: XP_038891909.1 (respiratory burst oxidase homolog protein E isoform X2 [Benincasa hispida]) HSP 1 Score: 119.0 bits (297), Expect = 1.5e-23 Identity = 55/63 (87.30%), Postives = 58/63 (92.06%), Query Frame = 0
BLAST of MELO3C034520 vs. NCBI nr
Match: XP_038891908.1 (respiratory burst oxidase homolog protein E isoform X1 [Benincasa hispida]) HSP 1 Score: 119.0 bits (297), Expect = 1.5e-23 Identity = 55/63 (87.30%), Postives = 58/63 (92.06%), Query Frame = 0
BLAST of MELO3C034520 vs. NCBI nr
Match: XP_022148315.1 (respiratory burst oxidase homolog protein E-like [Momordica charantia]) HSP 1 Score: 118.6 bits (296), Expect = 1.9e-23 Identity = 54/63 (85.71%), Postives = 59/63 (93.65%), Query Frame = 0
BLAST of MELO3C034520 vs. NCBI nr
Match: XP_022933049.1 (respiratory burst oxidase homolog protein E [Cucurbita moschata]) HSP 1 Score: 117.9 bits (294), Expect = 3.3e-23 Identity = 54/63 (85.71%), Postives = 58/63 (92.06%), Query Frame = 0
BLAST of MELO3C034520 vs. ExPASy Swiss-Prot
Match: O81211 (Respiratory burst oxidase homolog protein E OS=Arabidopsis thaliana OX=3702 GN=RBOHE PE=2 SV=2) HSP 1 Score: 88.2 bits (217), Expect = 3.7e-17 Identity = 40/63 (63.49%), Postives = 47/63 (74.60%), Query Frame = 0
BLAST of MELO3C034520 vs. ExPASy Swiss-Prot
Match: Q948U0 (Respiratory burst oxidase homolog protein A OS=Solanum tuberosum OX=4113 GN=RBOHA PE=1 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 1.1e-16 Identity = 37/61 (60.66%), Postives = 48/61 (78.69%), Query Frame = 0
BLAST of MELO3C034520 vs. ExPASy Swiss-Prot
Match: O48538 (Respiratory burst oxidase homolog protein F OS=Arabidopsis thaliana OX=3702 GN=RBOHF PE=1 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 1.5e-15 Identity = 35/63 (55.56%), Postives = 47/63 (74.60%), Query Frame = 0
BLAST of MELO3C034520 vs. ExPASy Swiss-Prot
Match: Q9LZU9 (Putative respiratory burst oxidase homolog protein J OS=Arabidopsis thaliana OX=3702 GN=RBOHJ PE=3 SV=2) HSP 1 Score: 80.5 bits (197), Expect = 7.7e-15 Identity = 33/61 (54.10%), Postives = 46/61 (75.41%), Query Frame = 0
BLAST of MELO3C034520 vs. ExPASy Swiss-Prot
Match: Q6J2K5 (Respiratory burst oxidase homolog protein B OS=Oryza sativa subsp. indica OX=39946 GN=RBOHB PE=2 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 1.0e-14 Identity = 36/61 (59.02%), Postives = 43/61 (70.49%), Query Frame = 0
BLAST of MELO3C034520 vs. ExPASy TrEMBL
Match: A0A0A0KSK1 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G529950 PE=3 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 1.5e-26 Identity = 60/63 (95.24%), Postives = 61/63 (96.83%), Query Frame = 0
BLAST of MELO3C034520 vs. ExPASy TrEMBL
Match: A0A6J1D2K5 (respiratory burst oxidase homolog protein E-like OS=Momordica charantia OX=3673 GN=LOC111016998 PE=4 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 9.4e-24 Identity = 54/63 (85.71%), Postives = 59/63 (93.65%), Query Frame = 0
BLAST of MELO3C034520 vs. ExPASy TrEMBL
Match: A0A6J1K4N6 (respiratory burst oxidase homolog protein E OS=Cucurbita maxima OX=3661 GN=LOC111492266 PE=3 SV=1) HSP 1 Score: 117.9 bits (294), Expect = 1.6e-23 Identity = 54/63 (85.71%), Postives = 58/63 (92.06%), Query Frame = 0
BLAST of MELO3C034520 vs. ExPASy TrEMBL
Match: A0A6J1EYN1 (respiratory burst oxidase homolog protein E OS=Cucurbita moschata OX=3662 GN=LOC111439761 PE=3 SV=1) HSP 1 Score: 117.9 bits (294), Expect = 1.6e-23 Identity = 54/63 (85.71%), Postives = 58/63 (92.06%), Query Frame = 0
BLAST of MELO3C034520 vs. ExPASy TrEMBL
Match: M1B222 (Respiratory burst oxidase OS=Solanum tuberosum OX=4113 GN=102588492 PE=3 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 7.4e-21 Identity = 49/63 (77.78%), Postives = 53/63 (84.13%), Query Frame = 0
BLAST of MELO3C034520 vs. TAIR 10
Match: AT1G19230.1 (Riboflavin synthase-like superfamily protein ) HSP 1 Score: 88.2 bits (217), Expect = 2.6e-18 Identity = 40/63 (63.49%), Postives = 47/63 (74.60%), Query Frame = 0
BLAST of MELO3C034520 vs. TAIR 10
Match: AT1G19230.2 (Riboflavin synthase-like superfamily protein ) HSP 1 Score: 88.2 bits (217), Expect = 2.6e-18 Identity = 40/63 (63.49%), Postives = 47/63 (74.60%), Query Frame = 0
BLAST of MELO3C034520 vs. TAIR 10
Match: AT1G64060.1 (respiratory burst oxidase protein F ) HSP 1 Score: 82.8 bits (203), Expect = 1.1e-16 Identity = 35/63 (55.56%), Postives = 47/63 (74.60%), Query Frame = 0
BLAST of MELO3C034520 vs. TAIR 10
Match: AT3G45810.1 (ferric reductase-like transmembrane component family protein ) HSP 1 Score: 80.5 bits (197), Expect = 5.4e-16 Identity = 33/61 (54.10%), Postives = 46/61 (75.41%), Query Frame = 0
BLAST of MELO3C034520 vs. TAIR 10
Match: AT4G11230.1 (Riboflavin synthase-like superfamily protein ) HSP 1 Score: 80.1 bits (196), Expect = 7.1e-16 Identity = 34/63 (53.97%), Postives = 45/63 (71.43%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|