![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MELO3C034266 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATCTAATGTAGTGAATCAACTTGAAAAAGATTTCTGAGAAGATGAATGGTGCATTCGATGCTGAACTTAAGGTCAGTTATATTTATAAATGAAACATTCCTGTTTTTTCTACTTCAGGTGAACAGACTTCAATGTCAATCTCGTTTTATCTTTTCAGGTTATTTACACAAAAGGTGGAATGTTTGCTCTAAGAGAAAGAAGGGTTCGTGTGACACAGGAAGATTTCGAAATGGCAGTTGCAAAGGTTATGAAGAAAGAGACAGATAA ATGAATCTAATGTAGTGAATCAACTTGAAAAAGATTTCTGAGAAGATGAATGGTGCATTCGATGCTGAACTTAAGGTTATTTACACAAAAGGTGGAATGTTTGCTCTAAGAGAAAGAAGGGTTCGTGTGACACAGGAAGATTTCGAAATGGCAGTTGCAAAGGTTATGAAGAAAGAGACAGATAA ATGAATGGTGCATTCGATGCTGAACTTAAGGTTATTTACACAAAAGGTGGAATGTTTGCTCTAAGAGAAAGAAGGGTTCGTGTGACACAGGAAGATTTCGAAATGGCAGTTGCAAAGGTTATGAAGAAAGAGACAGAT MNGAFDAELKVIYTKGGMFALRERRVRVTQEDFEMAVAKVMKKETD Homology
BLAST of MELO3C034266 vs. NCBI nr
Match: KAA0041016.1 (26S protease regulatory subunit 8 -like protein A [Cucumis melo var. makuwa] >TYK20375.1 26S protease regulatory subunit 8 -like protein A [Cucumis melo var. makuwa]) HSP 1 Score: 91.7 bits (226), Expect = 1.8e-15 Identity = 46/46 (100.00%), Postives = 46/46 (100.00%), Query Frame = 0
BLAST of MELO3C034266 vs. NCBI nr
Match: KAF5816981.1 (putative proteasome endopeptidase complex [Helianthus annuus]) HSP 1 Score: 74.7 bits (182), Expect = 2.3e-10 Identity = 38/46 (82.61%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MELO3C034266 vs. NCBI nr
Match: KAF3332553.1 (26S protease regulatory subunit 8 A [Carex littledalei]) HSP 1 Score: 74.7 bits (182), Expect = 2.3e-10 Identity = 38/46 (82.61%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MELO3C034266 vs. NCBI nr
Match: XP_035834898.1 (26S proteasome regulatory subunit 8 homolog B-like [Helianthus annuus] >XP_035834900.1 26S proteasome regulatory subunit 8 homolog B-like [Helianthus annuus]) HSP 1 Score: 74.7 bits (182), Expect = 2.3e-10 Identity = 38/46 (82.61%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MELO3C034266 vs. NCBI nr
Match: XP_022889711.1 (26S proteasome regulatory subunit 8 homolog A [Olea europaea var. sylvestris]) HSP 1 Score: 74.7 bits (182), Expect = 2.3e-10 Identity = 38/46 (82.61%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MELO3C034266 vs. ExPASy Swiss-Prot
Match: Q9C5U3 (26S proteasome regulatory subunit 8 homolog A OS=Arabidopsis thaliana OX=3702 GN=RPT6A PE=1 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 2.0e-12 Identity = 36/46 (78.26%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MELO3C034266 vs. ExPASy Swiss-Prot
Match: Q94BQ2 (26S proteasome regulatory subunit 8 homolog B OS=Arabidopsis thaliana OX=3702 GN=RPT6B PE=1 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 2.0e-12 Identity = 36/46 (78.26%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MELO3C034266 vs. ExPASy Swiss-Prot
Match: P34124 (26S proteasome regulatory subunit 8 OS=Dictyostelium discoideum OX=44689 GN=psmC5 PE=1 SV=2) HSP 1 Score: 66.6 bits (161), Expect = 8.2e-11 Identity = 32/46 (69.57%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MELO3C034266 vs. ExPASy Swiss-Prot
Match: P41836 (26S proteasome regulatory subunit 8 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=let1 PE=3 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 7.0e-10 Identity = 32/43 (74.42%), Postives = 36/43 (83.72%), Query Frame = 0
BLAST of MELO3C034266 vs. ExPASy Swiss-Prot
Match: P62194 (26S proteasome regulatory subunit 8 OS=Bos taurus OX=9913 GN=PSMC5 PE=2 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 1.6e-09 Identity = 31/46 (67.39%), Postives = 39/46 (84.78%), Query Frame = 0
BLAST of MELO3C034266 vs. ExPASy TrEMBL
Match: A0A5A7TG46 (26S protease regulatory subunit 8-like protein A OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold228G00790 PE=4 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 8.8e-16 Identity = 46/46 (100.00%), Postives = 46/46 (100.00%), Query Frame = 0
BLAST of MELO3C034266 vs. ExPASy TrEMBL
Match: A0A251TST9 (Putative ATPase, AAA-type, core OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr10g0316711 PE=3 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 1.1e-10 Identity = 38/46 (82.61%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MELO3C034266 vs. ExPASy TrEMBL
Match: A0A251VDA7 (Putative P-loop containing nucleoside triphosphate hydrolase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr02g0032621 PE=4 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 1.1e-10 Identity = 38/46 (82.61%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MELO3C034266 vs. ExPASy TrEMBL
Match: A0A1J3CW45 (26S protease regulatory subunit 8-like protein A (Fragment) OS=Noccaea caerulescens OX=107243 GN=GA_TR3647_c1_g1_i1_g.12400 PE=3 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 1.5e-10 Identity = 37/46 (80.43%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MELO3C034266 vs. ExPASy TrEMBL
Match: A0A7J6HXT8 (AAA domain-containing protein OS=Cannabis sativa OX=3483 GN=F8388_006413 PE=3 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 2.5e-10 Identity = 37/46 (80.43%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MELO3C034266 vs. TAIR 10
Match: AT5G19990.1 (regulatory particle triple-A ATPase 6A ) HSP 1 Score: 72.0 bits (175), Expect = 1.4e-13 Identity = 36/46 (78.26%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MELO3C034266 vs. TAIR 10
Match: AT5G20000.1 (AAA-type ATPase family protein ) HSP 1 Score: 72.0 bits (175), Expect = 1.4e-13 Identity = 36/46 (78.26%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MELO3C034266 vs. TAIR 10
Match: AT4G29040.1 (regulatory particle AAA-ATPase 2A ) HSP 1 Score: 41.2 bits (95), Expect = 2.6e-04 Identity = 20/40 (50.00%), Postives = 29/40 (72.50%), Query Frame = 0
BLAST of MELO3C034266 vs. TAIR 10
Match: AT2G20140.1 (AAA-type ATPase family protein ) HSP 1 Score: 40.8 bits (94), Expect = 3.4e-04 Identity = 20/40 (50.00%), Postives = 29/40 (72.50%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|