MELO3C033776 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.GTAGTCGCAGTGCTATTTTTTGGCGTGAACAGTGGTAACAAAATGGAAAAAGTTCCAGACTGGGATGACGAAGTGCTGGCTACAGCCCGATTTAAGGTATTTAGTGGGCAGAAATCTGATTGGGAACCCAGGTACTTATTTTGGAGGGATTTGATACTCGCAGTTGCCCGTCAATTCAACTTCCTTATTATAAAACCTTCTGAAATAAAAAATCAAT GTAGTCGCAGTGCTATTTTTTGGCGTGAACAGTGGTAACAAAATGGAAAAAGTTCCAGACTGGGATGACGAAGTGCTGGCTACAGCCCGATTTAAGGTATTTAGTGGGCAGAAATCTGATTGGGAACCCAGGTACTTATTTTGGAGGGATTTGATACTCGCAGTTGCCCGTCAATTCAACTTCCTTATTATAAAACCTTCTGAAATAAAAAATCAAT ATGGAAAAAGTTCCAGACTGGGATGACGAAGTGCTGGCTACAGCCCGATTTAAGGTATTTAGTGGGCAGAAATCTGATTGGGAACCCAGGTACTTATTTTGGAGGGATTTGATACTCGCAGTTGCCCGTCAATTCAACTTCCTTATTATAAAACCTTCTGAAATAAAAAATCAA MEKVPDWDDEVLATARFKVFSGQKSDWEPRYLFWRDLILAVARQFNFLIIKPSEIKNQ Homology
BLAST of MELO3C033776 vs. NCBI nr
Match: KGN50975.2 (hypothetical protein Csa_017819 [Cucumis sativus]) HSP 1 Score: 119.4 bits (298), Expect = 1.0e-23 Identity = 54/57 (94.74%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of MELO3C033776 vs. NCBI nr
Match: XP_011654554.1 (charged multivesicular body protein 7 [Cucumis sativus] >XP_031742319.1 charged multivesicular body protein 7 [Cucumis sativus] >XP_031742320.1 charged multivesicular body protein 7 [Cucumis sativus] >XP_031742321.1 charged multivesicular body protein 7 [Cucumis sativus] >XP_031742322.1 charged multivesicular body protein 7 [Cucumis sativus] >XP_031742323.1 charged multivesicular body protein 7 [Cucumis sativus] >XP_031742324.1 charged multivesicular body protein 7 [Cucumis sativus] >XP_031742325.1 charged multivesicular body protein 7 [Cucumis sativus] >XP_031742326.1 charged multivesicular body protein 7 [Cucumis sativus]) HSP 1 Score: 119.4 bits (298), Expect = 1.0e-23 Identity = 54/57 (94.74%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of MELO3C033776 vs. NCBI nr
Match: KAA0050281.1 (charged multivesicular body protein 7 isoform X2 [Cucumis melo var. makuwa] >TYJ98126.1 charged multivesicular body protein 7 isoform X2 [Cucumis melo var. makuwa]) HSP 1 Score: 113.2 bits (282), Expect = 7.4e-22 Identity = 52/57 (91.23%), Postives = 53/57 (92.98%), Query Frame = 0
BLAST of MELO3C033776 vs. NCBI nr
Match: XP_008466468.1 (PREDICTED: charged multivesicular body protein 7 isoform X2 [Cucumis melo]) HSP 1 Score: 113.2 bits (282), Expect = 7.4e-22 Identity = 52/57 (91.23%), Postives = 53/57 (92.98%), Query Frame = 0
BLAST of MELO3C033776 vs. NCBI nr
Match: XP_008466425.1 (PREDICTED: charged multivesicular body protein 7 isoform X1 [Cucumis melo] >XP_008466434.1 PREDICTED: charged multivesicular body protein 7 isoform X1 [Cucumis melo] >XP_008466443.1 PREDICTED: charged multivesicular body protein 7 isoform X1 [Cucumis melo] >XP_008466452.1 PREDICTED: charged multivesicular body protein 7 isoform X1 [Cucumis melo] >XP_008466460.1 PREDICTED: charged multivesicular body protein 7 isoform X1 [Cucumis melo]) HSP 1 Score: 113.2 bits (282), Expect = 7.4e-22 Identity = 52/57 (91.23%), Postives = 53/57 (92.98%), Query Frame = 0
BLAST of MELO3C033776 vs. ExPASy TrEMBL
Match: A0A0A0KMY2 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G118690 PE=4 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 5.0e-24 Identity = 54/57 (94.74%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of MELO3C033776 vs. ExPASy TrEMBL
Match: A0A1S3CRA4 (charged multivesicular body protein 7 isoform X1 OS=Cucumis melo OX=3656 GN=LOC103503835 PE=4 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 3.6e-22 Identity = 52/57 (91.23%), Postives = 53/57 (92.98%), Query Frame = 0
BLAST of MELO3C033776 vs. ExPASy TrEMBL
Match: A0A5D3BGE9 (Charged multivesicular body protein 7 isoform X2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold180G00010 PE=4 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 3.6e-22 Identity = 52/57 (91.23%), Postives = 53/57 (92.98%), Query Frame = 0
BLAST of MELO3C033776 vs. ExPASy TrEMBL
Match: A0A1S3CRC5 (charged multivesicular body protein 7 isoform X2 OS=Cucumis melo OX=3656 GN=LOC103503835 PE=4 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 3.6e-22 Identity = 52/57 (91.23%), Postives = 53/57 (92.98%), Query Frame = 0
BLAST of MELO3C033776 vs. ExPASy TrEMBL
Match: A0A6J1FF90 (charged multivesicular body protein 7 OS=Cucurbita moschata OX=3662 GN=LOC111444939 PE=4 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 1.8e-21 Identity = 47/57 (82.46%), Postives = 53/57 (92.98%), Query Frame = 0
BLAST of MELO3C033776 vs. TAIR 10
Match: AT3G62080.1 (SNF7 family protein ) HSP 1 Score: 84.7 bits (208), Expect = 2.6e-17 Identity = 35/54 (64.81%), Postives = 44/54 (81.48%), Query Frame = 0
BLAST of MELO3C033776 vs. TAIR 10
Match: AT3G62080.2 (SNF7 family protein ) HSP 1 Score: 84.7 bits (208), Expect = 2.6e-17 Identity = 35/54 (64.81%), Postives = 44/54 (81.48%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
|