![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MELO3C029009 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATTTATTGTTACAAATAATGGATCGGGACATGATGTTGTTGGCTTGAGGTGAGGATGTATTTAATTCATTCAACGAAAGGTGCTTGTTAAGTAATTTTATAGTGTTATGGAGTACGAAGAACATGAAAAACGAGCTTGGAGTGTTGATTTTTCACGTTCTGAACCTTCCATGCTTGTATCAAGCAGTGATGACTTTAAGGTATTTGACTAAAGCACACACTATCTTGAGTTGGTGAAGATCGATTATTGATTTAAAAATAGATTTGTGATTTTTTTCTGCATTGCAATTTTTTTCATCTTTTTCAATGGTTAGATTTGTAGCAGAGGATATTTGACTTGTCAACTATGGCACTTGGAAAATGCTATCCTTTGTTGAGTTTTATCTGTAAATTAGGGAATATAATTTTGGATCCATGCTGAAACTGTTACTACCACATGATTTGTAGAAATTATCCAGACAATTATGTATTACTCAAGTCTAGGCCAAAGGGTTAATAGTTTGTCAGTTGTTGGTGGCTTTTTCTTAAACAAGTTCTTCTCCTGCTTACTAACTTCAAGTTACAACATTCGGTTCTTTTTATTATGTTTTTTATGATACTATTCTCAGGTACATTGCTCCTTTTCTTTTAATAGGTCAAAATTTGGTGCACAAGACATTAGAAAATTGCTGACTTCAAATTGA ATTTATTGTTACAAATAATGGATCGGGACATGATGTTGTTGGCTTGAGTGTTATGGAGTACGAAGAACATGAAAAACGAGCTTGGAGTGTTGATTTTTCACGTTCTGAACCTTCCATGCTTGTATCAAGCAGTGATGACTTTAAGGTACATTGCTCCTTTTCTTTTAATAGGTCAAAATTTGGTGCACAAGACATTAGAAAATTGCTGACTTCAAATTGA ATGGAGTACGAAGAACATGAAAAACGAGCTTGGAGTGTTGATTTTTCACGTTCTGAACCTTCCATGCTTGTATCAAGCAGTGATGACTTTAAGGTACATTGCTCCTTTTCTTTTAATAGGTCAAAATTTGGTGCACAAGACATTAGAAAATTGCTGACTTCAAATTGA MEYEEHEKRAWSVDFSRSEPSMLVSSSDDFKVHCSFSFNRSKFGAQDIRKLLTSN Homology
BLAST of MELO3C029009 vs. NCBI nr
Match: XP_028554358.1 (E3 ubiquitin-protein ligase COP1 [Dendrobium catenatum] >PKU70650.1 E3 ubiquitin-protein ligase COP1 [Dendrobium catenatum]) HSP 1 Score: 63.2 bits (152), Expect = 8.3e-07 Identity = 29/32 (90.62%), Postives = 31/32 (96.88%), Query Frame = 0
BLAST of MELO3C029009 vs. NCBI nr
Match: XP_041003036.1 (LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase COP1-like [Juglans microcarpa x Juglans regia]) HSP 1 Score: 63.2 bits (152), Expect = 8.3e-07 Identity = 29/32 (90.62%), Postives = 31/32 (96.88%), Query Frame = 0
BLAST of MELO3C029009 vs. NCBI nr
Match: XP_018840782.1 (E3 ubiquitin-protein ligase COP1 [Juglans regia] >KAF5480994.1 hypothetical protein F2P56_001690 [Juglans regia]) HSP 1 Score: 63.2 bits (152), Expect = 8.3e-07 Identity = 29/32 (90.62%), Postives = 31/32 (96.88%), Query Frame = 0
BLAST of MELO3C029009 vs. NCBI nr
Match: KAF3971871.1 (hypothetical protein CMV_004573 [Castanea mollissima]) HSP 1 Score: 63.2 bits (152), Expect = 8.3e-07 Identity = 29/32 (90.62%), Postives = 31/32 (96.88%), Query Frame = 0
BLAST of MELO3C029009 vs. NCBI nr
Match: ANS59744.1 (ZFP7 [Betula platyphylla]) HSP 1 Score: 63.2 bits (152), Expect = 8.3e-07 Identity = 29/32 (90.62%), Postives = 31/32 (96.88%), Query Frame = 0
BLAST of MELO3C029009 vs. ExPASy Swiss-Prot
Match: P43254 (E3 ubiquitin-protein ligase COP1 OS=Arabidopsis thaliana OX=3702 GN=COP1 PE=1 SV=2) HSP 1 Score: 61.2 bits (147), Expect = 4.1e-09 Identity = 29/32 (90.62%), Postives = 30/32 (93.75%), Query Frame = 0
BLAST of MELO3C029009 vs. ExPASy Swiss-Prot
Match: P93471 (E3 ubiquitin-protein ligase COP1 OS=Pisum sativum OX=3888 GN=COP1 PE=2 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 9.2e-09 Identity = 28/32 (87.50%), Postives = 30/32 (93.75%), Query Frame = 0
BLAST of MELO3C029009 vs. ExPASy Swiss-Prot
Match: Q8NHY2 (E3 ubiquitin-protein ligase COP1 OS=Homo sapiens OX=9606 GN=COP1 PE=1 SV=1) HSP 1 Score: 45.1 bits (105), Expect = 3.1e-04 Identity = 19/30 (63.33%), Postives = 23/30 (76.67%), Query Frame = 0
BLAST of MELO3C029009 vs. ExPASy Swiss-Prot
Match: Q9R1A8 (E3 ubiquitin-protein ligase COP1 OS=Mus musculus OX=10090 GN=Cop1 PE=1 SV=2) HSP 1 Score: 45.1 bits (105), Expect = 3.1e-04 Identity = 19/30 (63.33%), Postives = 23/30 (76.67%), Query Frame = 0
BLAST of MELO3C029009 vs. ExPASy Swiss-Prot
Match: Q9SYX2 (Protein SUPPRESSOR OF PHYA-105 1 OS=Arabidopsis thaliana OX=3702 GN=SPA1 PE=1 SV=1) HSP 1 Score: 45.1 bits (105), Expect = 3.1e-04 Identity = 20/31 (64.52%), Postives = 24/31 (77.42%), Query Frame = 0
BLAST of MELO3C029009 vs. ExPASy TrEMBL
Match: A0A2P2KYZ1 (Uncharacterized protein OS=Rhizophora mucronata OX=61149 PE=4 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 1.8e-07 Identity = 30/32 (93.75%), Postives = 31/32 (96.88%), Query Frame = 0
BLAST of MELO3C029009 vs. ExPASy TrEMBL
Match: A0A2P2KZ19 (Ubiquitin ligase protein cop1 OS=Rhizophora mucronata OX=61149 PE=4 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 1.8e-07 Identity = 30/32 (93.75%), Postives = 31/32 (96.88%), Query Frame = 0
BLAST of MELO3C029009 vs. ExPASy TrEMBL
Match: A0A2P2KZ01 (Ubiquitin ligase protein cop1 OS=Rhizophora mucronata OX=61149 PE=4 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 1.8e-07 Identity = 30/32 (93.75%), Postives = 31/32 (96.88%), Query Frame = 0
BLAST of MELO3C029009 vs. ExPASy TrEMBL
Match: A0A6A1WGV3 (E3 ubiquitin-protein ligase COP1 OS=Morella rubra OX=262757 GN=CJ030_MR2G028791 PE=4 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 4.0e-07 Identity = 29/32 (90.62%), Postives = 31/32 (96.88%), Query Frame = 0
BLAST of MELO3C029009 vs. ExPASy TrEMBL
Match: A0A6A1WDW4 (E3 ubiquitin-protein ligase COP1 OS=Morella rubra OX=262757 GN=CJ030_MR2G028794 PE=4 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 4.0e-07 Identity = 29/32 (90.62%), Postives = 31/32 (96.88%), Query Frame = 0
BLAST of MELO3C029009 vs. TAIR 10
Match: AT2G32950.1 (Transducin/WD40 repeat-like superfamily protein ) HSP 1 Score: 61.2 bits (147), Expect = 2.9e-10 Identity = 29/32 (90.62%), Postives = 30/32 (93.75%), Query Frame = 0
BLAST of MELO3C029009 vs. TAIR 10
Match: AT2G46340.1 (SPA (suppressor of phyA-105) protein family ) HSP 1 Score: 45.1 bits (105), Expect = 2.2e-05 Identity = 20/31 (64.52%), Postives = 24/31 (77.42%), Query Frame = 0
BLAST of MELO3C029009 vs. TAIR 10
Match: AT1G53090.1 (SPA1-related 4 ) HSP 1 Score: 42.0 bits (97), Expect = 1.8e-04 Identity = 17/31 (54.84%), Postives = 24/31 (77.42%), Query Frame = 0
BLAST of MELO3C029009 vs. TAIR 10
Match: AT1G53090.2 (SPA1-related 4 ) HSP 1 Score: 42.0 bits (97), Expect = 1.8e-04 Identity = 17/31 (54.84%), Postives = 24/31 (77.42%), Query Frame = 0
BLAST of MELO3C029009 vs. TAIR 10
Match: AT4G11110.1 (SPA1-related 2 ) HSP 1 Score: 41.2 bits (95), Expect = 3.1e-04 Identity = 19/28 (67.86%), Postives = 21/28 (75.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|