![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MELO3C028915 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.TGAAATTTCATCTTCTGACTCTCGGTTAATTGAATCCCCCGCTCCTGGTATTATTTCGAGACGTTCCGTATACGAGCCTCTTCAAACAGGACTTATTGCTATTGATTCAATGATTCCTATCGGACGTGGTCAGCGAGAATTAATTAT TGAAATTTCATCTTCTGACTCTCGGTTAATTGAATCCCCCGCTCCTGGTATTATTTCGAGACGTTCCGTATACGAGCCTCTTCAAACAGGACTTATTGCTATTGATTCAATGATTCCTATCGGACGTGGTCAGCGAGAATTAATTAT GAAATTTCATCTTCTGACTCTCGGTTAATTGAATCCCCCGCTCCTGGTATTATTTCGAGACGTTCCGTATACGAGCCTCTTCAAACAGGACTTATTGCTATTGATTCAATGATTCCTATCGGACGTGGTCAGCGAGAATTAATT EISSSDSRLIESPAPGIISRRSVYEPLQTGLIAIDSMIPIGRGQRELI Homology
BLAST of MELO3C028915 vs. NCBI nr
Match: YP_009456131.1 (ATP synthase CF1 alpha subunit [Lagenaria siceraria] >QNM38516.1 ATP synthase CF1 alpha subunit [Lagenaria siceraria var. microcarpa] >AHM88686.1 ATP synthase CF1 alpha subunit [Lagenaria siceraria] >AHM88918.1 ATP synthase CF1 alpha subunit [Lagenaria siceraria] >AHM88976.1 ATP synthase CF1 alpha subunit [Lagenaria siceraria] >AHM89035.1 ATP synthase CF1 alpha subunit [Lagenaria siceraria]) HSP 1 Score: 94.4 bits (233), Expect = 2.9e-16 Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 0
BLAST of MELO3C028915 vs. NCBI nr
Match: YP_009317371.1 (ATP synthase CF1 alpha subunit [Coccinia grandis] >AOX48726.1 ATP synthase CF1 alpha subunit [Coccinia grandis] >AOX48811.1 ATP synthase CF1 alpha subunit [Coccinia grandis]) HSP 1 Score: 94.4 bits (233), Expect = 2.9e-16 Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 0
BLAST of MELO3C028915 vs. NCBI nr
Match: AHM90571.1 (ATP synthase CF1 alpha subunit [Lagenaria siceraria]) HSP 1 Score: 94.4 bits (233), Expect = 2.9e-16 Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 0
BLAST of MELO3C028915 vs. NCBI nr
Match: QHB75948.1 (ATP synthase CF1 alpha subunit [Cucumis melo subsp. melo]) HSP 1 Score: 94.4 bits (233), Expect = 2.9e-16 Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 0
BLAST of MELO3C028915 vs. NCBI nr
Match: YP_010131079.1 (ATP synthase CF1 alpha subunit [Benincasa hispida] >QPZ75726.1 ATP synthase CF1 alpha subunit [Benincasa hispida] >QSQ72295.1 CF1 subunit alpha [Benincasa hispida]) HSP 1 Score: 94.4 bits (233), Expect = 2.9e-16 Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 0
BLAST of MELO3C028915 vs. ExPASy Swiss-Prot
Match: Q70XV0 (ATP synthase subunit alpha, chloroplastic OS=Amborella trichopoda OX=13333 GN=atpA PE=3 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 1.1e-18 Identity = 47/48 (97.92%), Postives = 48/48 (100.00%), Query Frame = 0
BLAST of MELO3C028915 vs. ExPASy Swiss-Prot
Match: Q9BBS3 (ATP synthase subunit alpha, chloroplastic OS=Lotus japonicus OX=34305 GN=atpA PE=3 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 1.1e-18 Identity = 47/48 (97.92%), Postives = 48/48 (100.00%), Query Frame = 0
BLAST of MELO3C028915 vs. ExPASy Swiss-Prot
Match: Q3BAQ7 (ATP synthase subunit alpha, chloroplastic OS=Phalaenopsis aphrodite subsp. formosana OX=308872 GN=atpA PE=3 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 1.1e-18 Identity = 47/48 (97.92%), Postives = 48/48 (100.00%), Query Frame = 0
BLAST of MELO3C028915 vs. ExPASy Swiss-Prot
Match: Q2QDA3 (ATP synthase subunit alpha, chloroplastic OS=Cucumis sativus OX=3659 GN=atpA PE=3 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 1.9e-18 Identity = 47/48 (97.92%), Postives = 47/48 (97.92%), Query Frame = 0
BLAST of MELO3C028915 vs. ExPASy Swiss-Prot
Match: A6MM21 (ATP synthase subunit alpha, chloroplastic OS=Buxus microphylla OX=153571 GN=atpA PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 2.5e-18 Identity = 46/48 (95.83%), Postives = 48/48 (100.00%), Query Frame = 0
BLAST of MELO3C028915 vs. ExPASy TrEMBL
Match: A0A249RZY8 (ATP synthase subunit alpha, chloroplastic OS=Cucumis melo var. cantalupensis OX=3658 GN=atpA PE=3 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 1.4e-16 Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 0
BLAST of MELO3C028915 vs. ExPASy TrEMBL
Match: A0A1S4ETZ2 (ATP synthase subunit alpha, chloroplastic OS=Cucumis melo OX=3656 GN=atpA PE=3 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 1.4e-16 Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 0
BLAST of MELO3C028915 vs. ExPASy TrEMBL
Match: A0A1P8LFL2 (ATP synthase subunit alpha OS=Citrullus mucosospermus OX=519315 GN=atpA PE=3 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 1.4e-16 Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 0
BLAST of MELO3C028915 vs. ExPASy TrEMBL
Match: A0A2Z2CGF6 (ATP synthase subunit alpha, chloroplastic OS=Coccinia grandis OX=387127 GN=atpA PE=3 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 1.4e-16 Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 0
BLAST of MELO3C028915 vs. ExPASy TrEMBL
Match: X2F439 (ATP synthase subunit alpha, chloroplastic OS=Lagenaria siceraria OX=3668 GN=atpA PE=3 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 1.4e-16 Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 0
BLAST of MELO3C028915 vs. TAIR 10
Match: ATCG00120.1 (ATP synthase subunit alpha ) HSP 1 Score: 90.1 bits (222), Expect = 5.2e-19 Identity = 45/48 (93.75%), Postives = 48/48 (100.00%), Query Frame = 0
BLAST of MELO3C028915 vs. TAIR 10
Match: AT2G07698.1 (ATPase, F1 complex, alpha subunit protein ) HSP 1 Score: 65.5 bits (158), Expect = 1.4e-11 Identity = 28/47 (59.57%), Postives = 39/47 (82.98%), Query Frame = 0
BLAST of MELO3C028915 vs. TAIR 10
Match: ATMG01190.1 (ATP synthase subunit 1 ) HSP 1 Score: 65.5 bits (158), Expect = 1.4e-11 Identity = 28/47 (59.57%), Postives = 39/47 (82.98%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
|