
MELO3C025820 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GTTATAACCTTAGATATGGGCCTTCTTGTAGCTGGCACAAAATATCGTGGGGAGTTTGAAGAAAGATTAAAGAAACTGATGGAGGAAATAAAACAAAGTGATGGAGCAGGGGCTGCAGAAGGAGCTATTGATGCAGCAAACATATTAAAACCTACCCTTGCAAGGGGTCAACTGCAGGTATTCTCGTAA GTTATAACCTTAGATATGGGCCTTCTTGTAGCTGGCACAAAATATCGTGGGGAGTTTGAAGAAAGATTAAAGAAACTGATGGAGGAAATAAAACAAAGTGATGGAGCAGGGGCTGCAGAAGGAGCTATTGATGCAGCAAACATATTAAAACCTACCCTTGCAAGGGGTCAACTGCAGGTATTCTCGTAA ATGGGCCTTCTTGTAGCTGGCACAAAATATCGTGGGGAGTTTGAAGAAAGATTAAAGAAACTGATGGAGGAAATAAAACAAAGTGATGGAGCAGGGGCTGCAGAAGGAGCTATTGATGCAGCAAACATATTAAAACCTACCCTTGCAAGGGGTCAACTGCAGGTATTCTCGTAA MGLLVAGTKYRGEFEERLKKLMEEIKQSDGAGAAEGAIDAANILKPTLARGQLQVFS Homology
BLAST of MELO3C025820 vs. NCBI nr
Match: TYK21918.1 (Chaperone protein ClpC1 chloroplastic [Cucumis melo var. makuwa]) HSP 1 Score: 103.2 bits (256), Expect = 7.5e-19 Identity = 52/55 (94.55%), Postives = 54/55 (98.18%), Query Frame = 0
BLAST of MELO3C025820 vs. NCBI nr
Match: RWW18688.1 (hypothetical protein GW17_00017312 [Ensete ventricosum]) HSP 1 Score: 99.8 bits (247), Expect = 8.3e-18 Identity = 55/70 (78.57%), Postives = 56/70 (80.00%), Query Frame = 0
BLAST of MELO3C025820 vs. NCBI nr
Match: RWW57586.1 (hypothetical protein BHE74_00035611 [Ensete ventricosum] >RZR86386.1 hypothetical protein BHM03_00013573 [Ensete ventricosum]) HSP 1 Score: 99.8 bits (247), Expect = 8.3e-18 Identity = 55/70 (78.57%), Postives = 56/70 (80.00%), Query Frame = 0
BLAST of MELO3C025820 vs. NCBI nr
Match: RRT78584.1 (hypothetical protein B296_00023768 [Ensete ventricosum]) HSP 1 Score: 99.8 bits (247), Expect = 8.3e-18 Identity = 55/70 (78.57%), Postives = 56/70 (80.00%), Query Frame = 0
BLAST of MELO3C025820 vs. NCBI nr
Match: RWW26945.1 (hypothetical protein GW17_00008645 [Ensete ventricosum]) HSP 1 Score: 95.5 bits (236), Expect = 1.6e-16 Identity = 53/68 (77.94%), Postives = 54/68 (79.41%), Query Frame = 0
BLAST of MELO3C025820 vs. ExPASy Swiss-Prot
Match: P31541 (ATP-dependent Clp protease ATP-binding subunit ClpA homolog CD4A, chloroplastic OS=Solanum lycopersicum OX=4081 GN=CD4A PE=3 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 6.0e-19 Identity = 52/67 (77.61%), Postives = 53/67 (79.10%), Query Frame = 0
BLAST of MELO3C025820 vs. ExPASy Swiss-Prot
Match: P31542 (ATP-dependent Clp protease ATP-binding subunit ClpA homolog CD4B, chloroplastic OS=Solanum lycopersicum OX=4081 GN=CD4B PE=3 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 6.0e-19 Identity = 52/67 (77.61%), Postives = 53/67 (79.10%), Query Frame = 0
BLAST of MELO3C025820 vs. ExPASy Swiss-Prot
Match: Q2QVG9 (Chaperone protein ClpC2, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=CLPC2 PE=2 SV=2) HSP 1 Score: 94.0 bits (232), Expect = 6.0e-19 Identity = 52/67 (77.61%), Postives = 53/67 (79.10%), Query Frame = 0
BLAST of MELO3C025820 vs. ExPASy Swiss-Prot
Match: P35100 (Chaperone protein ClpC, chloroplastic OS=Pisum sativum OX=3888 PE=2 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 6.0e-19 Identity = 52/67 (77.61%), Postives = 53/67 (79.10%), Query Frame = 0
BLAST of MELO3C025820 vs. ExPASy Swiss-Prot
Match: Q9FI56 (Chaperone protein ClpC1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPC1 PE=1 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 1.3e-18 Identity = 51/67 (76.12%), Postives = 53/67 (79.10%), Query Frame = 0
BLAST of MELO3C025820 vs. ExPASy TrEMBL
Match: A0A5D3DEP3 (Chaperone protein ClpC1 chloroplastic OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold494G00600 PE=4 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 3.6e-19 Identity = 52/55 (94.55%), Postives = 54/55 (98.18%), Query Frame = 0
BLAST of MELO3C025820 vs. ExPASy TrEMBL
Match: A0A427AQR5 (Clp R domain-containing protein OS=Ensete ventricosum OX=4639 GN=B296_00023768 PE=4 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 4.0e-18 Identity = 55/70 (78.57%), Postives = 56/70 (80.00%), Query Frame = 0
BLAST of MELO3C025820 vs. ExPASy TrEMBL
Match: A0A444F7S8 (Clp R domain-containing protein OS=Ensete ventricosum OX=4639 GN=GW17_00017312 PE=4 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 4.0e-18 Identity = 55/70 (78.57%), Postives = 56/70 (80.00%), Query Frame = 0
BLAST of MELO3C025820 vs. ExPASy TrEMBL
Match: A0A427A9Q1 (Clp R domain-containing protein OS=Ensete ventricosum OX=4639 GN=B296_00003743 PE=4 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 7.6e-17 Identity = 53/68 (77.94%), Postives = 54/68 (79.41%), Query Frame = 0
BLAST of MELO3C025820 vs. ExPASy TrEMBL
Match: A0A2G2VGJ6 (Clp R domain-containing protein OS=Capsicum baccatum OX=33114 GN=CQW23_28406 PE=4 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 7.6e-17 Identity = 53/68 (77.94%), Postives = 54/68 (79.41%), Query Frame = 0
BLAST of MELO3C025820 vs. TAIR 10
Match: AT3G48870.1 (Clp ATPase ) HSP 1 Score: 92.8 bits (229), Expect = 9.5e-20 Identity = 51/67 (76.12%), Postives = 53/67 (79.10%), Query Frame = 0
BLAST of MELO3C025820 vs. TAIR 10
Match: AT3G48870.2 (Clp ATPase ) HSP 1 Score: 92.8 bits (229), Expect = 9.5e-20 Identity = 51/67 (76.12%), Postives = 53/67 (79.10%), Query Frame = 0
BLAST of MELO3C025820 vs. TAIR 10
Match: AT5G50920.1 (CLPC homologue 1 ) HSP 1 Score: 92.8 bits (229), Expect = 9.5e-20 Identity = 51/67 (76.12%), Postives = 53/67 (79.10%), Query Frame = 0
BLAST of MELO3C025820 vs. TAIR 10
Match: AT1G74310.1 (heat shock protein 101 ) HSP 1 Score: 68.6 bits (166), Expect = 1.9e-12 Identity = 35/68 (51.47%), Postives = 46/68 (67.65%), Query Frame = 0
BLAST of MELO3C025820 vs. TAIR 10
Match: AT5G15450.1 (casein lytic proteinase B3 ) HSP 1 Score: 65.5 bits (158), Expect = 1.6e-11 Identity = 33/68 (48.53%), Postives = 44/68 (64.71%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|