MELO3C013016 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTATGGCAACAGGAAAGTTGAGTATGGATTTGGAGCTGTTTTGATGGAGATAATTGTAGGAAGACCAGCATATCAAAATGGTGAGGATGGAGCTTTAACTCAATGGGTTAGCTCAATGTTTGGTAATGGGGAAATTGGAAGGATTGTGGATCCAAAATTAGAAGGAGATTTTGATGTAAACTCAGTGAAGGAAGCACTAAATATTGCATTTGCTTGTTTGTCTTACAACTCCAATGACCGACCAACCATGGGGGAAGTGCTACTAAAACTTAAACTTTGCTTGCAAATGGAAACAGCTCGATTGGCCATTGGGTACGGTCGTTGA ATGTATGGCAACAGGAAAGTTGAGTATGGATTTGGAGCTGTTTTGATGGAGATAATTGTAGGAAGACCAGCATATCAAAATGGTGAGGATGGAGCTTTAACTCAATGGGTTAGCTCAATGTTTGGTAATGGGGAAATTGGAAGGATTGTGGATCCAAAATTAGAAGGAGATTTTGATGTAAACTCAGTGAAGGAAGCACTAAATATTGCATTTGCTTGTTTGTCTTACAACTCCAATGACCGACCAACCATGGGGGAAGTGCTACTAAAACTTAAACTTTGCTTGCAAATGGAAACAGCTCGATTGGCCATTGGGTACGGTCGTTGA ATGTATGGCAACAGGAAAGTTGAGTATGGATTTGGAGCTGTTTTGATGGAGATAATTGTAGGAAGACCAGCATATCAAAATGGTGAGGATGGAGCTTTAACTCAATGGGTTAGCTCAATGTTTGGTAATGGGGAAATTGGAAGGATTGTGGATCCAAAATTAGAAGGAGATTTTGATGTAAACTCAGTGAAGGAAGCACTAAATATTGCATTTGCTTGTTTGTCTTACAACTCCAATGACCGACCAACCATGGGGGAAGTGCTACTAAAACTTAAACTTTGCTTGCAAATGGAAACAGCTCGATTGGCCATTGGGTACGGTCGTTGA MYGNRKVEYGFGAVLMEIIVGRPAYQNGEDGALTQWVSSMFGNGEIGRIVDPKLEGDFDVNSVKEALNIAFACLSYNSNDRPTMGEVLLKLKLCLQMETARLAIGYGR Homology
BLAST of MELO3C013016 vs. NCBI nr
Match: KAA0050874.1 (putative LRR receptor-like serine/threonine-protein kinase [Cucumis melo var. makuwa] >TYK08479.1 putative LRR receptor-like serine/threonine-protein kinase [Cucumis melo var. makuwa]) HSP 1 Score: 224.2 bits (570), Expect = 5.5e-55 Identity = 108/108 (100.00%), Postives = 108/108 (100.00%), Query Frame = 0
BLAST of MELO3C013016 vs. NCBI nr
Match: XP_004146864.1 (probable LRR receptor-like serine/threonine-protein kinase At1g51880 [Cucumis sativus]) HSP 1 Score: 177.9 bits (450), Expect = 4.5e-41 Identity = 86/94 (91.49%), Postives = 88/94 (93.62%), Query Frame = 0
BLAST of MELO3C013016 vs. NCBI nr
Match: KAE8651299.1 (hypothetical protein Csa_001862 [Cucumis sativus]) HSP 1 Score: 154.5 bits (389), Expect = 5.4e-34 Identity = 75/85 (88.24%), Postives = 77/85 (90.59%), Query Frame = 0
BLAST of MELO3C013016 vs. NCBI nr
Match: XP_022955772.1 (probable LRR receptor-like serine/threonine-protein kinase At1g51880 [Cucurbita moschata]) HSP 1 Score: 128.6 bits (322), Expect = 3.2e-26 Identity = 62/96 (64.58%), Postives = 76/96 (79.17%), Query Frame = 0
BLAST of MELO3C013016 vs. NCBI nr
Match: KAG6581867.1 (putative LRR receptor-like serine/threonine-protein kinase MEE39, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 128.3 bits (321), Expect = 4.1e-26 Identity = 62/96 (64.58%), Postives = 75/96 (78.12%), Query Frame = 0
BLAST of MELO3C013016 vs. ExPASy Swiss-Prot
Match: Q9C8I6 (LRR receptor-like serine/threonine-protein kinase IOS1 OS=Arabidopsis thaliana OX=3702 GN=IOS1 PE=1 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 8.1e-17 Identity = 40/94 (42.55%), Postives = 59/94 (62.77%), Query Frame = 0
BLAST of MELO3C013016 vs. ExPASy Swiss-Prot
Match: O81069 (Probable leucine-rich repeat receptor-like protein kinase At2g28990 OS=Arabidopsis thaliana OX=3702 GN=At2g28990 PE=1 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 5.3e-16 Identity = 45/101 (44.55%), Postives = 62/101 (61.39%), Query Frame = 0
BLAST of MELO3C013016 vs. ExPASy Swiss-Prot
Match: C0LGG6 (Probable LRR receptor-like protein kinase At1g51890 OS=Arabidopsis thaliana OX=3702 GN=At1g51890 PE=1 SV=2) HSP 1 Score: 84.0 bits (206), Expect = 1.2e-15 Identity = 40/94 (42.55%), Postives = 59/94 (62.77%), Query Frame = 0
BLAST of MELO3C013016 vs. ExPASy Swiss-Prot
Match: Q9FZB1 (Probable LRR receptor-like serine/threonine-protein kinase At1g51880 OS=Arabidopsis thaliana OX=3702 GN=At1g51880 PE=2 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 1.5e-15 Identity = 39/94 (41.49%), Postives = 58/94 (61.70%), Query Frame = 0
BLAST of MELO3C013016 vs. ExPASy Swiss-Prot
Match: C0LGG4 (Probable LRR receptor-like serine/threonine-protein kinase At1g51860 OS=Arabidopsis thaliana OX=3702 GN=At1g51860 PE=2 SV=2) HSP 1 Score: 82.8 bits (203), Expect = 2.6e-15 Identity = 39/94 (41.49%), Postives = 57/94 (60.64%), Query Frame = 0
BLAST of MELO3C013016 vs. ExPASy TrEMBL
Match: A0A5A7U6G6 (Putative LRR receptor-like serine/threonine-protein kinase OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold323G00040 PE=4 SV=1) HSP 1 Score: 224.2 bits (570), Expect = 2.7e-55 Identity = 108/108 (100.00%), Postives = 108/108 (100.00%), Query Frame = 0
BLAST of MELO3C013016 vs. ExPASy TrEMBL
Match: A0A0A0LCW9 (Protein kinase domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_3G850600 PE=4 SV=1) HSP 1 Score: 177.9 bits (450), Expect = 2.2e-41 Identity = 86/94 (91.49%), Postives = 88/94 (93.62%), Query Frame = 0
BLAST of MELO3C013016 vs. ExPASy TrEMBL
Match: A0A6J1GUI6 (probable LRR receptor-like serine/threonine-protein kinase At1g51880 OS=Cucurbita moschata OX=3662 GN=LOC111457663 PE=4 SV=1) HSP 1 Score: 128.6 bits (322), Expect = 1.5e-26 Identity = 62/96 (64.58%), Postives = 76/96 (79.17%), Query Frame = 0
BLAST of MELO3C013016 vs. ExPASy TrEMBL
Match: A0A5C7IHF1 (PK_Tyr_Ser-Thr domain-containing protein OS=Acer yangbiense OX=1000413 GN=EZV62_003655 PE=4 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 4.8e-20 Identity = 52/95 (54.74%), Postives = 67/95 (70.53%), Query Frame = 0
BLAST of MELO3C013016 vs. ExPASy TrEMBL
Match: A0A6P5WF81 (LRR receptor-like serine/threonine-protein kinase IOS1 OS=Durio zibethinus OX=66656 GN=LOC111274147 PE=4 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 4.8e-20 Identity = 52/103 (50.49%), Postives = 69/103 (66.99%), Query Frame = 0
BLAST of MELO3C013016 vs. TAIR 10
Match: AT1G51800.1 (Leucine-rich repeat protein kinase family protein ) HSP 1 Score: 87.8 bits (216), Expect = 5.8e-18 Identity = 40/94 (42.55%), Postives = 59/94 (62.77%), Query Frame = 0
BLAST of MELO3C013016 vs. TAIR 10
Match: AT2G28990.1 (Leucine-rich repeat protein kinase family protein ) HSP 1 Score: 85.1 bits (209), Expect = 3.7e-17 Identity = 45/101 (44.55%), Postives = 62/101 (61.39%), Query Frame = 0
BLAST of MELO3C013016 vs. TAIR 10
Match: AT1G51890.1 (Leucine-rich repeat protein kinase family protein ) HSP 1 Score: 84.0 bits (206), Expect = 8.3e-17 Identity = 40/94 (42.55%), Postives = 59/94 (62.77%), Query Frame = 0
BLAST of MELO3C013016 vs. TAIR 10
Match: AT1G51910.1 (Leucine-rich repeat protein kinase family protein ) HSP 1 Score: 84.0 bits (206), Expect = 8.3e-17 Identity = 41/94 (43.62%), Postives = 57/94 (60.64%), Query Frame = 0
BLAST of MELO3C013016 vs. TAIR 10
Match: AT1G51890.2 (Leucine-rich repeat protein kinase family protein ) HSP 1 Score: 84.0 bits (206), Expect = 8.3e-17 Identity = 40/94 (42.55%), Postives = 59/94 (62.77%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06
Relationships
The following mRNA feature(s) are a part of this gene:
|