MELO3C012519.jh1 (gene) Melon (Harukei-3) v1.41
Overview
Sequences
The following sequences are available for this feature:
Legend: exonstart_codonCDSpolypeptidestop_codon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCACTTGTTGATGTGACTTACCAGGTTGATTACTCAGATTGGTTACTTATTCTATCTTTCAAGAATTTTCATAGGAAAGCTGAATTGCAAGGAATGTATGCAAGACAGTCGCAGGCAAGGGAAGAGGTAGAGACGTTGTATGAAGAAGATGAAGACAAACACAATGACACCTTATGTGGGGCATGCGATGAGAATTATGCTTTAGATGAATTTTGGATTTGTTGTGATATCTGTGAGAAATGGTTCCATGGAAAATTTGTTGTATGA ATGGCACTTGTTGATGTGACTTACCAGGTTGATTACTCAGATTGGTTACTTATTCTATCTTTCAAGAATTTTCATAGGAAAGCTGAATTGCAAGGAATGTATGCAAGACAGTCGCAGGCAAGGGAAGAGGTAGAGACGTTGTATGAAGAAGATGAAGACAAACACAATGACACCTTATGTGGGGCATGCGATGAGAATTATGCTTTAGATGAATTTTGGATTTGTTGTGATATCTGTGAGAAATGGTTCCATGGAAAATTTGTTGTATGA ATGGCACTTGTTGATGTGACTTACCAGGTTGATTACTCAGATTGGTTACTTATTCTATCTTTCAAGAATTTTCATAGGAAAGCTGAATTGCAAGGAATGTATGCAAGACAGTCGCAGGCAAGGGAAGAGGTAGAGACGTTGTATGAAGAAGATGAAGACAAACACAATGACACCTTATGTGGGGCATGCGATGAGAATTATGCTTTAGATGAATTTTGGATTTGTTGTGATATCTGTGAGAAATGGTTCCATGGAAAATTTGTTGTATGA MALVDVTYQVDYSDWLLILSFKNFHRKAELQGMYARQSQAREEVETLYEEDEDKHNDTLCGACDENYALDEFWICCDICEKWFHGKFVV Homology
BLAST of MELO3C012519.jh1 vs. NCBI nr
Match: KAA0036625.1 (PHD finger protein ALFIN-LIKE 3-like isoform X1 [Cucumis melo var. makuwa] >TYK03364.1 PHD finger protein ALFIN-LIKE 3-like isoform X1 [Cucumis melo var. makuwa]) HSP 1 Score: 187 bits (476), Expect = 8.38e-60 Identity = 87/89 (97.75%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of MELO3C012519.jh1 vs. NCBI nr
Match: XP_008462330.1 (PREDICTED: PHD finger protein ALFIN-LIKE 3-like isoform X1 [Cucumis melo]) HSP 1 Score: 128 bits (322), Expect = 1.61e-34 Identity = 60/70 (85.71%), Postives = 63/70 (90.00%), Query Frame = 0
BLAST of MELO3C012519.jh1 vs. NCBI nr
Match: XP_004141692.1 (PHD finger protein ALFIN-LIKE 3 [Cucumis sativus] >KGN45504.1 hypothetical protein Csa_016627 [Cucumis sativus]) HSP 1 Score: 126 bits (316), Expect = 1.19e-33 Identity = 59/69 (85.51%), Postives = 63/69 (91.30%), Query Frame = 0
BLAST of MELO3C012519.jh1 vs. NCBI nr
Match: XP_038897957.1 (PHD finger protein ALFIN-LIKE 3-like [Benincasa hispida] >XP_038897958.1 PHD finger protein ALFIN-LIKE 3-like [Benincasa hispida]) HSP 1 Score: 124 bits (310), Expect = 9.24e-33 Identity = 58/69 (84.06%), Postives = 61/69 (88.41%), Query Frame = 0
BLAST of MELO3C012519.jh1 vs. NCBI nr
Match: XP_008462331.1 (PREDICTED: PHD finger protein ALFIN-LIKE 3-like isoform X2 [Cucumis melo] >KAA0059412.1 PHD finger protein ALFIN-LIKE 3-like isoform X2 [Cucumis melo var. makuwa] >TYK03915.1 PHD finger protein ALFIN-LIKE 3-like isoform X2 [Cucumis melo var. makuwa]) HSP 1 Score: 124 bits (310), Expect = 9.47e-33 Identity = 58/69 (84.06%), Postives = 62/69 (89.86%), Query Frame = 0
BLAST of MELO3C012519.jh1 vs. ExPASy Swiss-Prot
Match: Q5XEM9 (PHD finger protein ALFIN-LIKE 5 OS=Arabidopsis thaliana OX=3702 GN=AL5 PE=2 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 7.4e-16 Identity = 37/69 (53.62%), Postives = 47/69 (68.12%), Query Frame = 0
BLAST of MELO3C012519.jh1 vs. ExPASy Swiss-Prot
Match: Q9M2B4 (PHD finger protein ALFIN-LIKE 3 OS=Arabidopsis thaliana OX=3702 GN=AL3 PE=1 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 6.3e-15 Identity = 33/58 (56.90%), Postives = 43/58 (74.14%), Query Frame = 0
BLAST of MELO3C012519.jh1 vs. ExPASy Swiss-Prot
Match: Q9FFF5 (PHD finger protein ALFIN-LIKE 1 OS=Arabidopsis thaliana OX=3702 GN=AL1 PE=1 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 9.0e-14 Identity = 28/45 (62.22%), Postives = 37/45 (82.22%), Query Frame = 0
BLAST of MELO3C012519.jh1 vs. ExPASy Swiss-Prot
Match: O81488 (PHD finger protein ALFIN-LIKE 4 OS=Arabidopsis thaliana OX=3702 GN=AL4 PE=1 SV=2) HSP 1 Score: 77.4 bits (189), Expect = 9.0e-14 Identity = 32/47 (68.09%), Postives = 37/47 (78.72%), Query Frame = 0
BLAST of MELO3C012519.jh1 vs. ExPASy Swiss-Prot
Match: B8B8C5 (PHD finger protein ALFIN-LIKE 9 OS=Oryza sativa subsp. indica OX=39946 GN=OsI_26819 PE=3 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 7.6e-13 Identity = 28/37 (75.68%), Postives = 32/37 (86.49%), Query Frame = 0
BLAST of MELO3C012519.jh1 vs. ExPASy TrEMBL
Match: A0A5D3BW61 (PHD finger protein ALFIN-LIKE 3-like isoform X1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold2392G00260 PE=4 SV=1) HSP 1 Score: 187 bits (476), Expect = 4.06e-60 Identity = 87/89 (97.75%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of MELO3C012519.jh1 vs. ExPASy TrEMBL
Match: A0A1S3CI87 (PHD finger protein ALFIN-LIKE 3-like isoform X1 OS=Cucumis melo OX=3656 GN=LOC103500707 PE=3 SV=1) HSP 1 Score: 128 bits (322), Expect = 7.79e-35 Identity = 60/70 (85.71%), Postives = 63/70 (90.00%), Query Frame = 0
BLAST of MELO3C012519.jh1 vs. ExPASy TrEMBL
Match: A0A0A0K9L1 (PHD-type domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_7G450620 PE=3 SV=1) HSP 1 Score: 126 bits (316), Expect = 5.76e-34 Identity = 59/69 (85.51%), Postives = 63/69 (91.30%), Query Frame = 0
BLAST of MELO3C012519.jh1 vs. ExPASy TrEMBL
Match: A0A5D3BXQ0 (PHD finger protein ALFIN-LIKE 3-like isoform X2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold347G001120 PE=3 SV=1) HSP 1 Score: 124 bits (310), Expect = 4.58e-33 Identity = 58/69 (84.06%), Postives = 62/69 (89.86%), Query Frame = 0
BLAST of MELO3C012519.jh1 vs. ExPASy TrEMBL
Match: A0A1S3CGR0 (PHD finger protein ALFIN-LIKE 3-like isoform X2 OS=Cucumis melo OX=3656 GN=LOC103500707 PE=3 SV=1) HSP 1 Score: 124 bits (310), Expect = 4.58e-33 Identity = 58/69 (84.06%), Postives = 62/69 (89.86%), Query Frame = 0
BLAST of MELO3C012519.jh1 vs. TAIR 10
Match: AT5G20510.1 (alfin-like 5 ) HSP 1 Score: 84.3 bits (207), Expect = 5.2e-17 Identity = 37/69 (53.62%), Postives = 47/69 (68.12%), Query Frame = 0
BLAST of MELO3C012519.jh1 vs. TAIR 10
Match: AT3G42790.1 (alfin-like 3 ) HSP 1 Score: 81.3 bits (199), Expect = 4.4e-16 Identity = 33/58 (56.90%), Postives = 43/58 (74.14%), Query Frame = 0
BLAST of MELO3C012519.jh1 vs. TAIR 10
Match: AT5G26210.1 (alfin-like 4 ) HSP 1 Score: 77.4 bits (189), Expect = 6.4e-15 Identity = 32/47 (68.09%), Postives = 37/47 (78.72%), Query Frame = 0
BLAST of MELO3C012519.jh1 vs. TAIR 10
Match: AT5G05610.1 (alfin-like 1 ) HSP 1 Score: 77.4 bits (189), Expect = 6.4e-15 Identity = 28/45 (62.22%), Postives = 37/45 (82.22%), Query Frame = 0
BLAST of MELO3C012519.jh1 vs. TAIR 10
Match: AT5G05610.2 (alfin-like 1 ) HSP 1 Score: 77.4 bits (189), Expect = 6.4e-15 Identity = 28/45 (62.22%), Postives = 37/45 (82.22%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Harukei-3) v1.41
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|