MELO3C007910 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGAGATGCATTCACATTGGACTATTGTGTGTTCAAGAAAATGCAGTAGATCGACCGACAATGGCTTCGGTGGTTTTGATGCTGAGTAGTTTCTCTCTCACTCTCTCCGTGCCCTCCGACCCGGCATTCTTTATGCACAGTAATATTGAAGAATCTAACAGTGTGGTAAAACCAAATGGTGGTCATATGAAAAGCACATCTCTTGAGCCATCACTCAATGAAGTTTCAATTACTGAGCTCCGACCTCGCTAG ATGATGAGATGCATTCACATTGGACTATTGTGTGTTCAAGAAAATGCAGTAGATCGACCGACAATGGCTTCGGTGGTTTTGATGCTGAGTAGTTTCTCTCTCACTCTCTCCGTGCCCTCCGACCCGGCATTCTTTATGCACAGTAATATTGAAGAATCTAACAGTGTGGTAAAACCAAATGGTGGTCATATGAAAAGCACATCTCTTGAGCCATCACTCAATGAAGTTTCAATTACTGAGCTCCGACCTCGCTAG ATGATGAGATGCATTCACATTGGACTATTGTGTGTTCAAGAAAATGCAGTAGATCGACCGACAATGGCTTCGGTGGTTTTGATGCTGAGTAGTTTCTCTCTCACTCTCTCCGTGCCCTCCGACCCGGCATTCTTTATGCACAGTAATATTGAAGAATCTAACAGTGTGGTAAAACCAAATGGTGGTCATATGAAAAGCACATCTCTTGAGCCATCACTCAATGAAGTTTCAATTACTGAGCTCCGACCTCGCTAG MMRCIHIGLLCVQENAVDRPTMASVVLMLSSFSLTLSVPSDPAFFMHSNIEESNSVVKPNGGHMKSTSLEPSLNEVSITELRPR Homology
BLAST of MELO3C007910 vs. NCBI nr
Match: XP_004135028.1 (cysteine-rich receptor-like protein kinase 26 [Cucumis sativus]) HSP 1 Score: 148.3 bits (373), Expect = 3.0e-32 Identity = 75/84 (89.29%), Postives = 80/84 (95.24%), Query Frame = 0
BLAST of MELO3C007910 vs. NCBI nr
Match: KAA0025670.1 (cysteine-rich repeat secretory protein 38-like [Cucumis melo var. makuwa] >TYK12542.1 cysteine-rich repeat secretory protein 38-like [Cucumis melo var. makuwa]) HSP 1 Score: 131.7 bits (330), Expect = 2.9e-27 Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = 0
BLAST of MELO3C007910 vs. NCBI nr
Match: XP_022142134.1 (cysteine-rich receptor-like protein kinase 10 isoform X1 [Momordica charantia]) HSP 1 Score: 112.1 bits (279), Expect = 2.4e-21 Identity = 59/91 (64.84%), Postives = 71/91 (78.02%), Query Frame = 0
BLAST of MELO3C007910 vs. NCBI nr
Match: XP_022142135.1 (putative receptor-like protein kinase At4g00960 isoform X2 [Momordica charantia]) HSP 1 Score: 112.1 bits (279), Expect = 2.4e-21 Identity = 59/91 (64.84%), Postives = 71/91 (78.02%), Query Frame = 0
BLAST of MELO3C007910 vs. NCBI nr
Match: XP_022926744.1 (cysteine-rich receptor-like protein kinase 29 isoform X2 [Cucurbita moschata]) HSP 1 Score: 109.0 bits (271), Expect = 2.0e-20 Identity = 55/85 (64.71%), Postives = 69/85 (81.18%), Query Frame = 0
BLAST of MELO3C007910 vs. ExPASy Swiss-Prot
Match: Q8S9L6 (Cysteine-rich receptor-like protein kinase 29 OS=Arabidopsis thaliana OX=3702 GN=CRK29 PE=2 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 7.2e-13 Identity = 41/84 (48.81%), Postives = 55/84 (65.48%), Query Frame = 0
BLAST of MELO3C007910 vs. ExPASy Swiss-Prot
Match: Q9T0J1 (Cysteine-rich receptor-like protein kinase 26 OS=Arabidopsis thaliana OX=3702 GN=CRK26 PE=2 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 9.4e-13 Identity = 46/85 (54.12%), Postives = 56/85 (65.88%), Query Frame = 0
BLAST of MELO3C007910 vs. ExPASy Swiss-Prot
Match: O65405 (Cysteine-rich receptor-like protein kinase 28 OS=Arabidopsis thaliana OX=3702 GN=CRK28 PE=3 SV=2) HSP 1 Score: 73.9 bits (180), Expect = 9.4e-13 Identity = 44/87 (50.57%), Postives = 56/87 (64.37%), Query Frame = 0
BLAST of MELO3C007910 vs. ExPASy Swiss-Prot
Match: Q3E9X6 (Cysteine-rich receptor-like protein kinase 21 OS=Arabidopsis thaliana OX=3702 GN=CRK21 PE=2 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 3.6e-12 Identity = 38/84 (45.24%), Postives = 53/84 (63.10%), Query Frame = 0
BLAST of MELO3C007910 vs. ExPASy Swiss-Prot
Match: O23081 (Cysteine-rich receptor-like protein kinase 41 OS=Arabidopsis thaliana OX=3702 GN=CRK41 PE=3 SV=2) HSP 1 Score: 71.2 bits (173), Expect = 6.1e-12 Identity = 46/84 (54.76%), Postives = 55/84 (65.48%), Query Frame = 0
BLAST of MELO3C007910 vs. ExPASy TrEMBL
Match: A0A5A7SHP3 (Cysteine-rich repeat secretory protein 38-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold255G001240 PE=4 SV=1) HSP 1 Score: 131.7 bits (330), Expect = 1.4e-27 Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = 0
BLAST of MELO3C007910 vs. ExPASy TrEMBL
Match: A0A6J1CKQ2 (cysteine-rich receptor-like protein kinase 10 isoform X1 OS=Momordica charantia OX=3673 GN=LOC111012334 PE=4 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 1.2e-21 Identity = 59/91 (64.84%), Postives = 71/91 (78.02%), Query Frame = 0
BLAST of MELO3C007910 vs. ExPASy TrEMBL
Match: A0A6J1CK26 (putative receptor-like protein kinase At4g00960 isoform X2 OS=Momordica charantia OX=3673 GN=LOC111012334 PE=4 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 1.2e-21 Identity = 59/91 (64.84%), Postives = 71/91 (78.02%), Query Frame = 0
BLAST of MELO3C007910 vs. ExPASy TrEMBL
Match: A0A6J1EG17 (cysteine-rich receptor-like protein kinase 29 isoform X2 OS=Cucurbita moschata OX=3662 GN=LOC111433773 PE=3 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 9.8e-21 Identity = 55/85 (64.71%), Postives = 69/85 (81.18%), Query Frame = 0
BLAST of MELO3C007910 vs. ExPASy TrEMBL
Match: A0A6J1EJ27 (cysteine-rich receptor-like protein kinase 29 isoform X1 OS=Cucurbita moschata OX=3662 GN=LOC111433773 PE=4 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 9.8e-21 Identity = 55/85 (64.71%), Postives = 69/85 (81.18%), Query Frame = 0
BLAST of MELO3C007910 vs. TAIR 10
Match: AT4G21410.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 29 ) HSP 1 Score: 74.3 bits (181), Expect = 5.1e-14 Identity = 41/84 (48.81%), Postives = 55/84 (65.48%), Query Frame = 0
BLAST of MELO3C007910 vs. TAIR 10
Match: AT4G21400.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 28 ) HSP 1 Score: 73.9 bits (180), Expect = 6.7e-14 Identity = 44/87 (50.57%), Postives = 56/87 (64.37%), Query Frame = 0
BLAST of MELO3C007910 vs. TAIR 10
Match: AT4G38830.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 26 ) HSP 1 Score: 73.9 bits (180), Expect = 6.7e-14 Identity = 46/85 (54.12%), Postives = 56/85 (65.88%), Query Frame = 0
BLAST of MELO3C007910 vs. TAIR 10
Match: AT4G23290.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 21 ) HSP 1 Score: 72.0 bits (175), Expect = 2.5e-13 Identity = 38/84 (45.24%), Postives = 53/84 (63.10%), Query Frame = 0
BLAST of MELO3C007910 vs. TAIR 10
Match: AT4G23290.2 (cysteine-rich RLK (RECEPTOR-like protein kinase) 21 ) HSP 1 Score: 72.0 bits (175), Expect = 2.5e-13 Identity = 38/84 (45.24%), Postives = 53/84 (63.10%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06
Relationships
The following mRNA feature(s) are a part of this gene:
|