![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MELO3C001093.jh1 (gene) Melon (Harukei-3) v1.41
Overview
Sequences
The following sequences are available for this feature:
Legend: exonstart_codonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATTCCGGAAAGAATTTTTATCCAAACATTAATTGGTCGTGTATTAGCGGACGATATATATATGGGCCCGCGATGCATTGGTGTTCGAAATCAAGATATTGGTATTGGACTTATTAATCGATTCATAACCTTTCAAACCCAACCAATATCTATTCGGACTCCCTTTACTTGTAGGAGTACATCTTGGATCTGCCGATTATGTTATGGACGAAGTCCTACTCACGGGGACCTGGTAGAATTGGGAGAAGCCGTAGGTATTATTGCGGGTCAATCTATTGGAGAACCGGGTACTCAACTAACATTAAGAACTTTTCATACCGG ATGATTCCGGAAAGAATTTTTATCCAAACATTAATTGGTCGTGTATTAGCGGACGATATATATATGGGCCCGCGATGCATTGGTGTTCGAAATCAAGATATTGGTATTGGACTTATTAATCGATTCATAACCTTTCAAACCCAACCAATATCTATTCGGACTCCCTTTACTTGTAGGAGTACATCTTGGATCTGCCGATTATGTTATGGACGAAGTCCTACTCACGGGGACCTGGTAGAATTGGGAGAAGCCGTAGGTATTATTGCGGGTCAATCTATTGGAGAACCGGGTACTCAACTAACATTAAGAACTTTTCATACCGG ATGATTCCGGAAAGAATTTTTATCCAAACATTAATTGGTCGTGTATTAGCGGACGATATATATATGGGCCCGCGATGCATTGGTGTTCGAAATCAAGATATTGGTATTGGACTTATTAATCGATTCATAACCTTTCAAACCCAACCAATATCTATTCGGACTCCCTTTACTTGTAGGAGTACATCTTGGATCTGCCGATTATGTTATGGACGAAGTCCTACTCACGGGGACCTGGTAGAATTGGGAGAAGCCGTAGGTATTATTGCGGGTCAATCTATTGGAGAACCGGGTACTCAACTAACATTAAGAACTTTTCATACC MIPERIFIQTLIGRVLADDIYMGPRCIGVRNQDIGIGLINRFITFQTQPISIRTPFTCRSTSWICRLCYGRSPTHGDLVELGEAVGIIAGQSIGEPGTQLTLRTFHT Homology
BLAST of MELO3C001093.jh1 vs. NCBI nr
Match: ABK55745.1 (chloroplast RNA polymerase protein, partial [Cucumis sativus]) HSP 1 Score: 223 bits (567), Expect = 2.17e-72 Identity = 106/107 (99.07%), Postives = 106/107 (99.07%), Query Frame = 0
BLAST of MELO3C001093.jh1 vs. NCBI nr
Match: WP_210471843.1 (hypothetical protein, partial [Sporosarcina sp. 6E9]) HSP 1 Score: 211 bits (536), Expect = 2.45e-68 Identity = 98/107 (91.59%), Postives = 103/107 (96.26%), Query Frame = 0
BLAST of MELO3C001093.jh1 vs. NCBI nr
Match: CAP11921.1 (RNA polymerase beta subunit, partial [Sophora toromiro]) HSP 1 Score: 212 bits (539), Expect = 1.84e-67 Identity = 99/107 (92.52%), Postives = 104/107 (97.20%), Query Frame = 0
BLAST of MELO3C001093.jh1 vs. NCBI nr
Match: CAP11920.1 (RNA polymerase beta subunit, partial [Sophora microphylla]) HSP 1 Score: 212 bits (539), Expect = 1.84e-67 Identity = 99/107 (92.52%), Postives = 104/107 (97.20%), Query Frame = 0
BLAST of MELO3C001093.jh1 vs. NCBI nr
Match: CAP11918.1 (RNA polymerase beta subunit, partial [Paeonia kavachensis] >CAP11919.1 RNA polymerase beta subunit, partial [Paeonia tenuifolia]) HSP 1 Score: 212 bits (539), Expect = 2.22e-67 Identity = 98/105 (93.33%), Postives = 102/105 (97.14%), Query Frame = 0
BLAST of MELO3C001093.jh1 vs. ExPASy Swiss-Prot
Match: Q4VZP3 (DNA-directed RNA polymerase subunit beta'' OS=Cucumis sativus OX=3659 GN=rpoC2 PE=3 SV=1) HSP 1 Score: 226.5 bits (576), Expect = 1.4e-58 Identity = 107/107 (100.00%), Postives = 107/107 (100.00%), Query Frame = 0
BLAST of MELO3C001093.jh1 vs. ExPASy Swiss-Prot
Match: Q49L08 (DNA-directed RNA polymerase subunit beta'' OS=Eucalyptus globulus subsp. globulus OX=71271 GN=rpoC2 PE=3 SV=1) HSP 1 Score: 220.7 bits (561), Expect = 7.9e-57 Identity = 102/107 (95.33%), Postives = 106/107 (99.07%), Query Frame = 0
BLAST of MELO3C001093.jh1 vs. ExPASy Swiss-Prot
Match: Q3C1G9 (DNA-directed RNA polymerase subunit beta'' OS=Nicotiana sylvestris OX=4096 GN=rpoC2 PE=3 SV=1) HSP 1 Score: 217.6 bits (553), Expect = 6.7e-56 Identity = 101/107 (94.39%), Postives = 104/107 (97.20%), Query Frame = 0
BLAST of MELO3C001093.jh1 vs. ExPASy Swiss-Prot
Match: P38550 (DNA-directed RNA polymerase subunit beta'' OS=Nicotiana tabacum OX=4097 GN=rpoC2 PE=3 SV=2) HSP 1 Score: 217.6 bits (553), Expect = 6.7e-56 Identity = 101/107 (94.39%), Postives = 104/107 (97.20%), Query Frame = 0
BLAST of MELO3C001093.jh1 vs. ExPASy Swiss-Prot
Match: Q0ZJ30 (DNA-directed RNA polymerase subunit beta'' OS=Vitis vinifera OX=29760 GN=rpoC2 PE=3 SV=1) HSP 1 Score: 217.2 bits (552), Expect = 8.8e-56 Identity = 101/107 (94.39%), Postives = 104/107 (97.20%), Query Frame = 0
BLAST of MELO3C001093.jh1 vs. ExPASy TrEMBL
Match: A1BQP4 (DNA-directed RNA polymerase (Fragment) OS=Cucumis sativus OX=3659 PE=2 SV=1) HSP 1 Score: 223 bits (567), Expect = 1.05e-72 Identity = 106/107 (99.07%), Postives = 106/107 (99.07%), Query Frame = 0
BLAST of MELO3C001093.jh1 vs. ExPASy TrEMBL
Match: B0BEG8 (DNA-directed RNA polymerase (Fragment) OS=Sophora microphylla OX=70607 GN=rpoC2 PE=4 SV=1) HSP 1 Score: 212 bits (539), Expect = 8.89e-68 Identity = 99/107 (92.52%), Postives = 104/107 (97.20%), Query Frame = 0
BLAST of MELO3C001093.jh1 vs. ExPASy TrEMBL
Match: B0BEG9 (DNA-directed RNA polymerase (Fragment) OS=Sophora toromiro OX=85268 GN=rpoC2 PE=4 SV=1) HSP 1 Score: 212 bits (539), Expect = 8.89e-68 Identity = 99/107 (92.52%), Postives = 104/107 (97.20%), Query Frame = 0
BLAST of MELO3C001093.jh1 vs. ExPASy TrEMBL
Match: B0BEG6 (DNA-directed RNA polymerase (Fragment) OS=Paeonia kavachensis OX=476178 GN=rpoC2 PE=4 SV=1) HSP 1 Score: 212 bits (539), Expect = 1.08e-67 Identity = 98/105 (93.33%), Postives = 102/105 (97.14%), Query Frame = 0
BLAST of MELO3C001093.jh1 vs. ExPASy TrEMBL
Match: B0BEG7 (DNA-directed RNA polymerase (Fragment) OS=Paeonia tenuifolia OX=13626 GN=rpoC2 PE=4 SV=1) HSP 1 Score: 212 bits (539), Expect = 1.08e-67 Identity = 98/105 (93.33%), Postives = 102/105 (97.14%), Query Frame = 0
BLAST of MELO3C001093.jh1 vs. TAIR 10
Match: ATCG00170.1 (DNA-directed RNA polymerase family protein ) HSP 1 Score: 203.8 bits (517), Expect = 7.1e-53 Identity = 95/107 (88.79%), Postives = 100/107 (93.46%), Query Frame = 0
BLAST of MELO3C001093.jh1 vs. TAIR 10
Match: AT5G60040.1 (nuclear RNA polymerase C1 ) HSP 1 Score: 47.0 bits (110), Expect = 1.1e-05 Identity = 19/28 (67.86%), Postives = 23/28 (82.14%), Query Frame = 0
BLAST of MELO3C001093.jh1 vs. TAIR 10
Match: AT5G60040.2 (nuclear RNA polymerase C1 ) HSP 1 Score: 47.0 bits (110), Expect = 1.1e-05 Identity = 19/28 (67.86%), Postives = 23/28 (82.14%), Query Frame = 0
BLAST of MELO3C001093.jh1 vs. TAIR 10
Match: AT3G57660.1 (nuclear RNA polymerase A1 ) HSP 1 Score: 46.6 bits (109), Expect = 1.5e-05 Identity = 19/36 (52.78%), Postives = 25/36 (69.44%), Query Frame = 0
BLAST of MELO3C001093.jh1 vs. TAIR 10
Match: AT4G35800.1 (RNA polymerase II large subunit ) HSP 1 Score: 44.3 bits (103), Expect = 7.2e-05 Identity = 19/29 (65.52%), Postives = 22/29 (75.86%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Harukei-3) v1.41
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|