![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MELO3C000955 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTGTTTTAGATTGGACTATTCTGAATGCTGATTTTCCACTTGTTGGATTTTATGCTATGAAGGATGTCGCAGTTGCGGATCTTGCTCCCACTCATCCGATCAGGCTGGGGCTGGCACTCAATTTCTCCGTGTTTTACTTCGAGATTCTGAATCAGTCCGATAAAGCATGTAGCATGGCCAAGGAG ATGGGTGTTTTAGATTGGACTATTCTGAATGCTGATTTTCCACTTGTTGGATTTTATGCTATGAAGGATGTCGCAGTTGCGGATCTTGCTCCCACTCATCCGATCAGGCTGGGGCTGGCACTCAATTTCTCCGTGTTTTACTTCGAGATTCTGAATCAGTCCGATAAAGCATGTAGCATGGCCAAGGAG ATGGGTGTTTTAGATTGGACTATTCTGAATGCTGATTTTCCACTTGTTGGATTTTATGCTATGAAGGATGTCGCAGTTGCGGATCTTGCTCCCACTCATCCGATCAGGCTGGGGCTGGCACTCAATTTCTCCGTGTTTTACTTCGAGATTCTGAATCAGTCCGATAAAGCATGTAGCATGGCCAAGGAG MGVLDWTILNADFPLVGFYAMKDVAVADLAPTHPIRLGLALNFSVFYFEILNQSDKACSMAKE Homology
BLAST of MELO3C000955 vs. NCBI nr
Match: KAA0055951.1 (14-3-3-like protein B [Cucumis melo var. makuwa]) HSP 1 Score: 122.9 bits (307), Expect = 1.0e-24 Identity = 58/59 (98.31%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MELO3C000955 vs. NCBI nr
Match: TYK29091.1 (14-3-3-like protein B [Cucumis melo var. makuwa]) HSP 1 Score: 90.1 bits (222), Expect = 7.3e-15 Identity = 43/53 (81.13%), Postives = 48/53 (90.57%), Query Frame = 0
BLAST of MELO3C000955 vs. NCBI nr
Match: XP_022131869.1 (14-3-3 protein 10 isoform X1 [Momordica charantia] >XP_022131870.1 14-3-3 protein 10 isoform X2 [Momordica charantia]) HSP 1 Score: 90.1 bits (222), Expect = 7.3e-15 Identity = 43/53 (81.13%), Postives = 48/53 (90.57%), Query Frame = 0
BLAST of MELO3C000955 vs. NCBI nr
Match: KAA0065077.1 (14-3-3-like protein B [Cucumis melo var. makuwa]) HSP 1 Score: 90.1 bits (222), Expect = 7.3e-15 Identity = 43/53 (81.13%), Postives = 48/53 (90.57%), Query Frame = 0
BLAST of MELO3C000955 vs. NCBI nr
Match: XP_004148413.1 (14-3-3 protein 10 [Cucumis sativus] >XP_038885153.1 14-3-3 protein 10 [Benincasa hispida] >KGN62768.1 hypothetical protein Csa_022528 [Cucumis sativus]) HSP 1 Score: 90.1 bits (222), Expect = 7.3e-15 Identity = 43/53 (81.13%), Postives = 48/53 (90.57%), Query Frame = 0
BLAST of MELO3C000955 vs. ExPASy Swiss-Prot
Match: P48348 (14-3-3-like protein GF14 kappa OS=Arabidopsis thaliana OX=3702 GN=GRF8 PE=1 SV=2) HSP 1 Score: 85.1 bits (209), Expect = 3.1e-16 Identity = 39/53 (73.58%), Postives = 47/53 (88.68%), Query Frame = 0
BLAST of MELO3C000955 vs. ExPASy Swiss-Prot
Match: P42645 (14-3-3-like protein GF14 upsilon OS=Arabidopsis thaliana OX=3702 GN=GRF5 PE=1 SV=2) HSP 1 Score: 83.2 bits (204), Expect = 1.2e-15 Identity = 37/53 (69.81%), Postives = 47/53 (88.68%), Query Frame = 0
BLAST of MELO3C000955 vs. ExPASy Swiss-Prot
Match: P93206 (14-3-3 protein 1 OS=Solanum lycopersicum OX=4081 GN=TFT1 PE=3 SV=2) HSP 1 Score: 82.0 bits (201), Expect = 2.6e-15 Identity = 37/53 (69.81%), Postives = 47/53 (88.68%), Query Frame = 0
BLAST of MELO3C000955 vs. ExPASy Swiss-Prot
Match: P48349 (14-3-3-like protein GF14 lambda OS=Arabidopsis thaliana OX=3702 GN=GRF6 PE=1 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 2.6e-15 Identity = 36/53 (67.92%), Postives = 46/53 (86.79%), Query Frame = 0
BLAST of MELO3C000955 vs. ExPASy Swiss-Prot
Match: Q6ZKC0 (14-3-3-like protein GF14-C OS=Oryza sativa subsp. japonica OX=39947 GN=GF14C PE=1 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 3.4e-15 Identity = 36/53 (67.92%), Postives = 46/53 (86.79%), Query Frame = 0
BLAST of MELO3C000955 vs. ExPASy TrEMBL
Match: A0A5A7UQV7 (14-3-3-like protein B OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold319G00770 PE=3 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 4.9e-25 Identity = 58/59 (98.31%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MELO3C000955 vs. ExPASy TrEMBL
Match: A0A6J1BQW4 (14-3-3 protein 10 isoform X1 OS=Momordica charantia OX=3673 GN=LOC111004908 PE=3 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 3.5e-15 Identity = 43/53 (81.13%), Postives = 48/53 (90.57%), Query Frame = 0
BLAST of MELO3C000955 vs. ExPASy TrEMBL
Match: A0A5A7VDF0 (14-3-3-like protein B OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold82G004070 PE=3 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 3.5e-15 Identity = 43/53 (81.13%), Postives = 48/53 (90.57%), Query Frame = 0
BLAST of MELO3C000955 vs. ExPASy TrEMBL
Match: A0A5D3BQ54 (14-3-3-like protein B OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold827G00040 PE=3 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 3.5e-15 Identity = 43/53 (81.13%), Postives = 48/53 (90.57%), Query Frame = 0
BLAST of MELO3C000955 vs. ExPASy TrEMBL
Match: A0A5D3E059 (14-3-3-like protein B OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold120G002230 PE=3 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 3.5e-15 Identity = 43/53 (81.13%), Postives = 48/53 (90.57%), Query Frame = 0
BLAST of MELO3C000955 vs. TAIR 10
Match: AT5G65430.1 (general regulatory factor 8 ) HSP 1 Score: 85.1 bits (209), Expect = 2.2e-17 Identity = 39/53 (73.58%), Postives = 47/53 (88.68%), Query Frame = 0
BLAST of MELO3C000955 vs. TAIR 10
Match: AT5G65430.2 (general regulatory factor 8 ) HSP 1 Score: 85.1 bits (209), Expect = 2.2e-17 Identity = 39/53 (73.58%), Postives = 47/53 (88.68%), Query Frame = 0
BLAST of MELO3C000955 vs. TAIR 10
Match: AT5G65430.3 (general regulatory factor 8 ) HSP 1 Score: 85.1 bits (209), Expect = 2.2e-17 Identity = 39/53 (73.58%), Postives = 47/53 (88.68%), Query Frame = 0
BLAST of MELO3C000955 vs. TAIR 10
Match: AT5G16050.1 (general regulatory factor 5 ) HSP 1 Score: 83.2 bits (204), Expect = 8.3e-17 Identity = 37/53 (69.81%), Postives = 47/53 (88.68%), Query Frame = 0
BLAST of MELO3C000955 vs. TAIR 10
Match: AT5G10450.1 (G-box regulating factor 6 ) HSP 1 Score: 82.0 bits (201), Expect = 1.8e-16 Identity = 36/53 (67.92%), Postives = 46/53 (86.79%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
|