
MELO.jh100449.1 (gene) Melon (Harukei-3) v1.41
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCAAAGCCTCACATATTACTGTTGGATGAACCAACGAATCACTTGGACATGCAGAGTATTGATGCACTTGCAGATGCCTTGGATGAATTCACCGGCGGAGTTGTTCTGGTTAGTCATGATTCACGACTCATTTCACGTGTGTGGGAGAATGAAGAAAAAAGTGAAATTTGGGTCGTCGAAAATGGCACTGTGGAGTTTTTCCCTGGCACTTTCGAGGAATACAAGGAAGAATTGCAAAAGGAGATTAAAGCTGAGGTTGATGATTAG ATGTCAAAGCCTCACATATTACTGTTGGATGAACCAACGAATCACTTGGACATGCAGAGTATTGATGCACTTGCAGATGCCTTGGATGAATTCACCGGCGGAGTTGTTCTGGTTAGTCATGATTCACGACTCATTTCACGTGTGTGGGAGAATGAAGAAAAAAGTGAAATTTGGGTCGTCGAAAATGGCACTGTGGAGTTTTTCCCTGGCACTTTCGAGGAATACAAGGAAGAATTGCAAAAGGAGATTAAAGCTGAGGTTGATGATTAG ATGTCAAAGCCTCACATATTACTGTTGGATGAACCAACGAATCACTTGGACATGCAGAGTATTGATGCACTTGCAGATGCCTTGGATGAATTCACCGGCGGAGTTGTTCTGGTTAGTCATGATTCACGACTCATTTCACGTGTGTGGGAGAATGAAGAAAAAAGTGAAATTTGGGTCGTCGAAAATGGCACTGTGGAGTTTTTCCCTGGCACTTTCGAGGAATACAAGGAAGAATTGCAAAAGGAGATTAAAGCTGAGGTTGATGATTAG MSKPHILLLDEPTNHLDMQSIDALADALDEFTGGVVLVSHDSRLISRVWENEEKSEIWVVENGTVEFFPGTFEEYKEELQKEIKAEVDD Homology
BLAST of MELO.jh100449.1 vs. NCBI nr
Match: XP_008462810.1 (PREDICTED: ABC transporter F family member 4-like [Cucumis melo] >XP_008462811.1 PREDICTED: ABC transporter F family member 4-like [Cucumis melo] >KAA0066330.1 ABC transporter F family member 4-like [Cucumis melo var. makuwa] >TYK00949.1 ABC transporter F family member 4-like [Cucumis melo var. makuwa]) HSP 1 Score: 173 bits (438), Expect = 2.98e-48 Identity = 87/89 (97.75%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of MELO.jh100449.1 vs. NCBI nr
Match: XP_004151853.3 (ABC transporter F family member 4 [Cucumis sativus] >XP_011650048.2 ABC transporter F family member 4 [Cucumis sativus] >XP_031736813.1 ABC transporter F family member 4 [Cucumis sativus] >KAE8652333.1 hypothetical protein Csa_022120 [Cucumis sativus]) HSP 1 Score: 173 bits (438), Expect = 2.98e-48 Identity = 87/89 (97.75%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of MELO.jh100449.1 vs. NCBI nr
Match: XP_022966192.1 (ABC transporter F family member 4-like [Cucurbita maxima]) HSP 1 Score: 173 bits (438), Expect = 3.00e-48 Identity = 87/89 (97.75%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of MELO.jh100449.1 vs. NCBI nr
Match: XP_022925094.1 (ABC transporter F family member 4-like [Cucurbita moschata]) HSP 1 Score: 173 bits (438), Expect = 3.00e-48 Identity = 87/89 (97.75%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of MELO.jh100449.1 vs. NCBI nr
Match: XP_023517557.1 (ABC transporter F family member 4-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 173 bits (438), Expect = 3.00e-48 Identity = 87/89 (97.75%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of MELO.jh100449.1 vs. ExPASy Swiss-Prot
Match: Q9M1H3 (ABC transporter F family member 4 OS=Arabidopsis thaliana OX=3702 GN=ABCF4 PE=2 SV=1) HSP 1 Score: 162.5 bits (410), Expect = 2.1e-39 Identity = 80/89 (89.89%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of MELO.jh100449.1 vs. ExPASy Swiss-Prot
Match: Q9USH9 (Uncharacterized ABC transporter ATP-binding protein C825.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC825.01 PE=1 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 1.4e-19 Identity = 49/89 (55.06%), Postives = 66/89 (74.16%), Query Frame = 0
BLAST of MELO.jh100449.1 vs. ExPASy Swiss-Prot
Match: Q8T6B4 (ABC transporter F family member 4 OS=Dictyostelium discoideum OX=44689 GN=abcF4 PE=3 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 7.1e-19 Identity = 45/83 (54.22%), Postives = 65/83 (78.31%), Query Frame = 0
BLAST of MELO.jh100449.1 vs. ExPASy Swiss-Prot
Match: Q9UG63 (ATP-binding cassette sub-family F member 2 OS=Homo sapiens OX=9606 GN=ABCF2 PE=1 SV=2) HSP 1 Score: 90.1 bits (222), Expect = 1.3e-17 Identity = 45/83 (54.22%), Postives = 59/83 (71.08%), Query Frame = 0
BLAST of MELO.jh100449.1 vs. ExPASy Swiss-Prot
Match: Q99LE6 (ATP-binding cassette sub-family F member 2 OS=Mus musculus OX=10090 GN=Abcf2 PE=1 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.3e-17 Identity = 45/83 (54.22%), Postives = 59/83 (71.08%), Query Frame = 0
BLAST of MELO.jh100449.1 vs. ExPASy TrEMBL
Match: A0A0A0KYC4 (ABC transporter domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_4G417490 PE=4 SV=1) HSP 1 Score: 172 bits (435), Expect = 1.91e-50 Identity = 86/89 (96.63%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of MELO.jh100449.1 vs. ExPASy TrEMBL
Match: A0A803R2K4 (Uncharacterized protein OS=Cannabis sativa OX=3483 PE=4 SV=1) HSP 1 Score: 162 bits (409), Expect = 4.00e-50 Identity = 81/89 (91.01%), Postives = 86/89 (96.63%), Query Frame = 0
BLAST of MELO.jh100449.1 vs. ExPASy TrEMBL
Match: A0A803R2K3 (Uncharacterized protein OS=Cannabis sativa OX=3483 PE=4 SV=1) HSP 1 Score: 162 bits (409), Expect = 4.00e-50 Identity = 81/89 (91.01%), Postives = 86/89 (96.63%), Query Frame = 0
BLAST of MELO.jh100449.1 vs. ExPASy TrEMBL
Match: A0A803R2K5 (Uncharacterized protein OS=Cannabis sativa OX=3483 PE=4 SV=1) HSP 1 Score: 162 bits (409), Expect = 4.00e-50 Identity = 81/89 (91.01%), Postives = 86/89 (96.63%), Query Frame = 0
BLAST of MELO.jh100449.1 vs. ExPASy TrEMBL
Match: A0A1S3CJD6 (ABC transporter F family member 4-like OS=Cucumis melo OX=3656 GN=LOC103501091 PE=4 SV=1) HSP 1 Score: 173 bits (438), Expect = 1.44e-48 Identity = 87/89 (97.75%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of MELO.jh100449.1 vs. TAIR 10
Match: AT3G54540.1 (general control non-repressible 4 ) HSP 1 Score: 162.5 bits (410), Expect = 1.5e-40 Identity = 80/89 (89.89%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of MELO.jh100449.1 vs. TAIR 10
Match: AT1G64550.1 (general control non-repressible 3 ) HSP 1 Score: 80.1 bits (196), Expect = 9.9e-16 Identity = 39/78 (50.00%), Postives = 52/78 (66.67%), Query Frame = 0
BLAST of MELO.jh100449.1 vs. TAIR 10
Match: AT5G60790.1 (ABC transporter family protein ) HSP 1 Score: 77.8 bits (190), Expect = 4.9e-15 Identity = 42/87 (48.28%), Postives = 61/87 (70.11%), Query Frame = 0
BLAST of MELO.jh100449.1 vs. TAIR 10
Match: AT5G64840.1 (general control non-repressible 5 ) HSP 1 Score: 55.8 bits (133), Expect = 2.0e-08 Identity = 32/89 (35.96%), Postives = 52/89 (58.43%), Query Frame = 0
BLAST of MELO.jh100449.1 vs. TAIR 10
Match: AT5G09930.1 (ABC transporter family protein ) HSP 1 Score: 51.2 bits (121), Expect = 4.9e-07 Identity = 31/86 (36.05%), Postives = 51/86 (59.30%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Harukei-3) v1.41
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
|