MC11g1449 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TGCGGGAAACTGAAAGAGGGAGAAGAACTTATTAACAGTATGGCAATTGAAGGCTTCTTTCTTGCAGCTTGTAGAGTACATGGAGATATTGAAATTGGGAAAATAGCAGCGAAAAAGGTGATGGAGTTGAAGCCATATGGTACTGGTGCTTTTGTG TGCGGGAAACTGAAAGAGGGAGAAGAACTTATTAACAGTATGGCAATTGAAGGCTTCTTTCTTGCAGCTTGTAGAGTACATGGAGATATTGAAATTGGGAAAATAGCAGCGAAAAAGGTGATGGAGTTGAAGCCATATGGTACTGGTGCTTTTGTG TGCGGGAAACTGAAAGAGGGAGAAGAACTTATTAACAGTATGGCAATTGAAGGCTTCTTTCTTGCAGCTTGTAGAGTACATGGAGATATTGAAATTGGGAAAATAGCAGCGAAAAAGGTGATGGAGTTGAAGCCATATGGTACTGGTGCTTTTGTG CGKLKEGEELINSMAIEGFFLAACRVHGDIEIGKIAAKKVMELKPYGTGAFV Homology
BLAST of MC11g1449 vs. ExPASy Swiss-Prot
Match: Q9CA56 (Pentatricopeptide repeat-containing protein At1g74600, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PCMP-E69 PE=3 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 1.3e-09 Identity = 27/57 (47.37%), Postives = 41/57 (71.93%), Query Frame = 0
BLAST of MC11g1449 vs. ExPASy Swiss-Prot
Match: O23337 (Pentatricopeptide repeat-containing protein At4g14820 OS=Arabidopsis thaliana OX=3702 GN=PCMP-H3 PE=2 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 1.1e-06 Identity = 25/55 (45.45%), Postives = 37/55 (67.27%), Query Frame = 0
BLAST of MC11g1449 vs. ExPASy Swiss-Prot
Match: Q9SHZ8 (Pentatricopeptide repeat-containing protein At2g22070 OS=Arabidopsis thaliana OX=3702 GN=PCMP-H41 PE=3 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 3.1e-06 Identity = 24/56 (42.86%), Postives = 38/56 (67.86%), Query Frame = 0
BLAST of MC11g1449 vs. ExPASy Swiss-Prot
Match: Q9SJZ3 (Pentatricopeptide repeat-containing protein At2g22410, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PCMP-E28 PE=2 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 5.3e-06 Identity = 24/57 (42.11%), Postives = 37/57 (64.91%), Query Frame = 0
BLAST of MC11g1449 vs. ExPASy Swiss-Prot
Match: Q9SMZ2 (Pentatricopeptide repeat-containing protein At4g33170 OS=Arabidopsis thaliana OX=3702 GN=PCMP-H53 PE=3 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 6.9e-06 Identity = 26/57 (45.61%), Postives = 35/57 (61.40%), Query Frame = 0
BLAST of MC11g1449 vs. NCBI nr
Match: XP_038893557.1 (pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Benincasa hispida]) HSP 1 Score: 80.5 bits (197), Expect = 6.41e-16 Identity = 41/58 (70.69%), Postives = 45/58 (77.59%), Query Frame = 0
BLAST of MC11g1449 vs. NCBI nr
Match: XP_022137435.1 (pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Momordica charantia] >XP_022137436.1 pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Momordica charantia] >XP_022137437.1 pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Momordica charantia] >XP_022137439.1 pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Momordica charantia]) HSP 1 Score: 79.3 bits (194), Expect = 1.63e-15 Identity = 40/58 (68.97%), Postives = 45/58 (77.59%), Query Frame = 0
BLAST of MC11g1449 vs. NCBI nr
Match: XP_008441907.1 (PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Cucumis melo]) HSP 1 Score: 77.0 bits (188), Expect = 1.06e-14 Identity = 39/58 (67.24%), Postives = 44/58 (75.86%), Query Frame = 0
BLAST of MC11g1449 vs. NCBI nr
Match: KAA0036077.1 (pentatricopeptide repeat-containing protein [Cucumis melo var. makuwa]) HSP 1 Score: 77.0 bits (188), Expect = 1.06e-14 Identity = 39/58 (67.24%), Postives = 44/58 (75.86%), Query Frame = 0
BLAST of MC11g1449 vs. NCBI nr
Match: TYJ98884.1 (pentatricopeptide repeat-containing protein [Cucumis melo var. makuwa]) HSP 1 Score: 77.0 bits (188), Expect = 1.06e-14 Identity = 39/58 (67.24%), Postives = 44/58 (75.86%), Query Frame = 0
BLAST of MC11g1449 vs. ExPASy TrEMBL
Match: A0A6J1C6M8 (pentatricopeptide repeat-containing protein At1g74600, chloroplastic OS=Momordica charantia OX=3673 GN=LOC111008883 PE=4 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 7.91e-16 Identity = 40/58 (68.97%), Postives = 45/58 (77.59%), Query Frame = 0
BLAST of MC11g1449 vs. ExPASy TrEMBL
Match: A0A1S3B4I2 (pentatricopeptide repeat-containing protein At1g74600, chloroplastic OS=Cucumis melo OX=3656 GN=LOC103485891 PE=4 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 5.14e-15 Identity = 39/58 (67.24%), Postives = 44/58 (75.86%), Query Frame = 0
BLAST of MC11g1449 vs. ExPASy TrEMBL
Match: A0A5A7T3B5 (Pentatricopeptide repeat-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold112G00710 PE=4 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 5.14e-15 Identity = 39/58 (67.24%), Postives = 44/58 (75.86%), Query Frame = 0
BLAST of MC11g1449 vs. ExPASy TrEMBL
Match: A0A5D3BIJ5 (Pentatricopeptide repeat-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold248G00800 PE=4 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 5.14e-15 Identity = 39/58 (67.24%), Postives = 44/58 (75.86%), Query Frame = 0
BLAST of MC11g1449 vs. ExPASy TrEMBL
Match: A0A6J1KIC5 (pentatricopeptide repeat-containing protein At1g74600, chloroplastic OS=Cucurbita maxima OX=3661 GN=LOC111495501 PE=4 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 7.02e-15 Identity = 38/58 (65.52%), Postives = 45/58 (77.59%), Query Frame = 0
BLAST of MC11g1449 vs. TAIR 10
Match: AT1G74600.1 (pentatricopeptide (PPR) repeat-containing protein ) HSP 1 Score: 62.8 bits (151), Expect = 9.6e-11 Identity = 27/57 (47.37%), Postives = 41/57 (71.93%), Query Frame = 0
BLAST of MC11g1449 vs. TAIR 10
Match: AT4G14820.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 53.1 bits (126), Expect = 7.6e-08 Identity = 25/55 (45.45%), Postives = 37/55 (67.27%), Query Frame = 0
BLAST of MC11g1449 vs. TAIR 10
Match: AT2G22070.1 (pentatricopeptide (PPR) repeat-containing protein ) HSP 1 Score: 51.6 bits (122), Expect = 2.2e-07 Identity = 24/56 (42.86%), Postives = 38/56 (67.86%), Query Frame = 0
BLAST of MC11g1449 vs. TAIR 10
Match: AT2G22410.1 (SLOW GROWTH 1 ) HSP 1 Score: 50.8 bits (120), Expect = 3.8e-07 Identity = 24/57 (42.11%), Postives = 37/57 (64.91%), Query Frame = 0
BLAST of MC11g1449 vs. TAIR 10
Match: AT4G33170.1 (Tetratricopeptide repeat (TPR)-like superfamily protein ) HSP 1 Score: 50.4 bits (119), Expect = 4.9e-07 Identity = 26/57 (45.61%), Postives = 35/57 (61.40%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|