
MC11g1074 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATTCGACAAGTCTGGTCCCACAATCTCCGGCAAGAGCTGGCCATTCTCCACGACTCTCTCTCCCGCTTTCCGGTGGTCGCCTTCGACACTGAGTTCCCGGGGTTCCTCCGATCCACCTGGAGAGGAGCTCCGGCGGAAGAATCCTACCAAGATCTCAAGTTCAATGTGGACGATTCGATTTCCAAAAACACAGGACTCACGGAATCCCATCTGTCGAGTTCCGACTCCGGTTCCATCCCATATGCTATAGTGGTCGGATCTCCAAATGGGTCACCTTCCACGGCTTCTACGATGTCGGTTACCTGCTCAACCTACTCATCATCAAAATCATGCAGGAATCCATGTCCCGCTTCGCT ATTCGACAAGTCTGGTCCCACAATCTCCGGCAAGAGCTGGCCATTCTCCACGACTCTCTCTCCCGCTTTCCGGTGGTCGCCTTCGACACTGAGTTCCCGGGGTTCCTCCGATCCACCTGGAGAGGAGCTCCGGCGGAAGAATCCTACCAAGATCTCAAGTTCAATGTGGACTTCGATTTCCAAAAACACAGGACTCACGGAATCCCATCTGTCGAGTTCCGACTCCGGTTCCATCCCATATGCTATAGTGGTCGGATCTCCAAATGGGTCACCTTCCACGGCTTCTACGATGTCGGTTACCTGCTCAACCTACTCATCATCAAAATCATGCAGGAATCCATGTCCCGCTTCGCT ATTCGACAAGTCTGGTCCCACAATCTCCGGCAAGAGCTGGCCATTCTCCACGACTCTCTCTCCCGCTTTCCGGTGGTCGCCTTCGACACTGAGTTCCCGGGGTTCCTCCGATCCACCTGGAGAGGAGCTCCGGCGGAAGAATCCTACCAAGATCTCAAGTTCAATGTGGACTTCGATTTCCAAAAACACAGGACTCACGGAATCCCATCTGTCGAGTTCCGACTCCGGTTCCATCCCATATGCTATAGTGGTCGGATCTCCAAATGGGTCACCTTCCACGGCTTCTACGATGTCGGTTACCTGCTCAACCTACTCATCATCAAAATCATGCAGGAATCCATGTCCCGCTTCGCT IRQVWSHNLRQELAILHDSLSRFPVVAFDTEFPGFLRSTWRGAPAEESYQDLKFNVDFDFQKHRTHGIPSVEFRLRFHPICYSGRISKWVTFHGFYDVGYLLNLLIIKIMQESMSRFA Homology
BLAST of MC11g1074 vs. ExPASy Swiss-Prot
Match: Q9S9P2 (Probable CCR4-associated factor 1 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=CAF1-2 PE=1 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 6.1e-10 Identity = 52/182 (28.57%), Postives = 70/182 (38.46%), Query Frame = 0
BLAST of MC11g1074 vs. ExPASy Swiss-Prot
Match: O64773 (Probable CCR4-associated factor 1 homolog 5 OS=Arabidopsis thaliana OX=3702 GN=CAF1-5 PE=2 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 4.0e-09 Identity = 48/163 (29.45%), Postives = 62/163 (38.04%), Query Frame = 0
BLAST of MC11g1074 vs. ExPASy Swiss-Prot
Match: Q9SHJ0 (Probable CCR4-associated factor 1 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=CAF1-1 PE=2 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 5.8e-08 Identity = 23/56 (41.07%), Postives = 40/56 (71.43%), Query Frame = 0
BLAST of MC11g1074 vs. ExPASy Swiss-Prot
Match: Q9SKZ2 (Probable CCR4-associated factor 1 homolog 7 OS=Arabidopsis thaliana OX=3702 GN=CAF1-7 PE=2 SV=2) HSP 1 Score: 57.4 bits (137), Expect = 1.3e-07 Identity = 49/178 (27.53%), Postives = 68/178 (38.20%), Query Frame = 0
BLAST of MC11g1074 vs. ExPASy Swiss-Prot
Match: Q9SAI2 (Probable CCR4-associated factor 1 homolog 6 OS=Arabidopsis thaliana OX=3702 GN=CAF1-6 PE=1 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 2.2e-07 Identity = 48/177 (27.12%), Postives = 70/177 (39.55%), Query Frame = 0
BLAST of MC11g1074 vs. NCBI nr
Match: XP_004151393.1 (putative CCR4-associated factor 1 homolog 8 [Cucumis sativus]) HSP 1 Score: 147 bits (371), Expect = 2.68e-41 Identity = 81/167 (48.50%), Postives = 91/167 (54.49%), Query Frame = 0
BLAST of MC11g1074 vs. NCBI nr
Match: KAE8649090.1 (hypothetical protein Csa_014788 [Cucumis sativus]) HSP 1 Score: 147 bits (371), Expect = 2.14e-40 Identity = 81/167 (48.50%), Postives = 91/167 (54.49%), Query Frame = 0
BLAST of MC11g1074 vs. NCBI nr
Match: KAA0044544.1 (putative CCR4-associated factor 1-like protein 8 [Cucumis melo var. makuwa]) HSP 1 Score: 145 bits (365), Expect = 2.71e-40 Identity = 78/167 (46.71%), Postives = 91/167 (54.49%), Query Frame = 0
BLAST of MC11g1074 vs. NCBI nr
Match: TYK17042.1 (putative CCR4-associated factor 1-like protein 8 [Cucumis melo var. makuwa]) HSP 1 Score: 141 bits (355), Expect = 1.24e-39 Identity = 77/161 (47.83%), Postives = 91/161 (56.52%), Query Frame = 0
BLAST of MC11g1074 vs. NCBI nr
Match: XP_008454486.1 (PREDICTED: putative CCR4-associated factor 1 homolog 8 [Cucumis melo] >TYK17039.1 putative CCR4-associated factor 1-like protein 8 [Cucumis melo var. makuwa]) HSP 1 Score: 142 bits (357), Expect = 4.31e-39 Identity = 77/167 (46.11%), Postives = 91/167 (54.49%), Query Frame = 0
BLAST of MC11g1074 vs. ExPASy TrEMBL
Match: A0A0A0KTU4 (Poly(A)-specific ribonuclease OS=Cucumis sativus OX=3659 GN=Csa_4G011090 PE=3 SV=1) HSP 1 Score: 147 bits (371), Expect = 1.30e-41 Identity = 81/167 (48.50%), Postives = 91/167 (54.49%), Query Frame = 0
BLAST of MC11g1074 vs. ExPASy TrEMBL
Match: A0A5A7TN62 (Poly(A)-specific ribonuclease OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold46G002920 PE=3 SV=1) HSP 1 Score: 145 bits (365), Expect = 1.31e-40 Identity = 78/167 (46.71%), Postives = 91/167 (54.49%), Query Frame = 0
BLAST of MC11g1074 vs. ExPASy TrEMBL
Match: A0A5D3CZR2 (Poly(A)-specific ribonuclease OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold130G001900 PE=3 SV=1) HSP 1 Score: 141 bits (355), Expect = 5.98e-40 Identity = 77/161 (47.83%), Postives = 91/161 (56.52%), Query Frame = 0
BLAST of MC11g1074 vs. ExPASy TrEMBL
Match: A0A5D3D333 (Poly(A)-specific ribonuclease OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold130G001870 PE=3 SV=1) HSP 1 Score: 142 bits (357), Expect = 2.09e-39 Identity = 77/167 (46.11%), Postives = 91/167 (54.49%), Query Frame = 0
BLAST of MC11g1074 vs. ExPASy TrEMBL
Match: A0A1S3BY95 (Poly(A)-specific ribonuclease OS=Cucumis melo OX=3656 GN=LOC103494884 PE=3 SV=1) HSP 1 Score: 142 bits (357), Expect = 2.09e-39 Identity = 77/167 (46.11%), Postives = 91/167 (54.49%), Query Frame = 0
BLAST of MC11g1074 vs. TAIR 10
Match: AT1G15920.2 (Polynucleotidyl transferase, ribonuclease H-like superfamily protein ) HSP 1 Score: 65.1 bits (157), Expect = 4.4e-11 Identity = 52/182 (28.57%), Postives = 70/182 (38.46%), Query Frame = 0
BLAST of MC11g1074 vs. TAIR 10
Match: AT1G15920.1 (Polynucleotidyl transferase, ribonuclease H-like superfamily protein ) HSP 1 Score: 65.1 bits (157), Expect = 4.4e-11 Identity = 52/182 (28.57%), Postives = 70/182 (38.46%), Query Frame = 0
BLAST of MC11g1074 vs. TAIR 10
Match: AT1G61470.1 (Polynucleotidyl transferase, ribonuclease H-like superfamily protein ) HSP 1 Score: 62.4 bits (150), Expect = 2.8e-10 Identity = 48/163 (29.45%), Postives = 62/163 (38.04%), Query Frame = 0
BLAST of MC11g1074 vs. TAIR 10
Match: AT1G06450.1 (Polynucleotidyl transferase, ribonuclease H-like superfamily protein ) HSP 1 Score: 58.5 bits (140), Expect = 4.1e-09 Identity = 23/56 (41.07%), Postives = 40/56 (71.43%), Query Frame = 0
BLAST of MC11g1074 vs. TAIR 10
Match: AT2G32070.1 (Polynucleotidyl transferase, ribonuclease H-like superfamily protein ) HSP 1 Score: 57.4 bits (137), Expect = 9.1e-09 Identity = 49/178 (27.53%), Postives = 68/178 (38.20%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|