MC11g1060 (gene) Bitter gourd (Dali-11) v1

Overview


Name	MC11g1060
Type	gene
Organism	Momordica charantia cv. Dali-11 (Bitter gourd (Dali-11) v1)
Description	Unknown protein
Location	MC11: 9065898 .. 9065987 (+)
RNA-Seq Expression	MC11g1060
Synteny	MC11g1060

Sequences

The following sequences are available for this feature:

Legend: CDSpolypeptide

Hold the cursor over a type above to highlight its positions in the sequence below.

GTTCAACAATATCGTCCAACAGTTTGTCAATTCTATACAAGATGTGCCAAACGAGTGCCACAATCATTTACAATTCATGGCGTGTGGCCT

GTTCAACAATATCGTCCAACAGTTTGTCAATTCTATACAAGATGTGCCAAACGAGTGCCACAATCATTTACAATTCATGGCGTGTGGCCT

GTTCAACAATATCGTCCAACAGTTTGTCAATTCTATACAAGATGTGCCAAACGAGTGCCACAATCATTTACAATTCATGGCGTGTGGCCT

VQQYRPTVCQFYTRCAKRVPQSFTIHGVWP

Homology

The following BLAST results are available for this feature:


Match Name	E-value	Identity	Description


Match Name	E-value	Identity	Description


Match Name	E-value	Identity	Description


Match Name	E-value	Identity	Description

InterPro

Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25

Position :

Zoom :

x 1


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
IPR001568	Ribonuclease T2-like	PFAM	PF00445	Ribonuclease_T2	coord: 1..30 e-value: 9.6E-5 score: 22.6
IPR036430	Ribonuclease T2-like superfamily	GENE3D	3.90.730.10		coord: 1..30 e-value: 3.0E-6 score: 29.2
IPR036430	Ribonuclease T2-like superfamily	SUPERFAMILY	55895	Ribonuclease Rh-like	coord: 1..30

Relationships

The following mRNA feature(s) are a part of this gene:


Feature Name	Unique Name	Type
MC11g1060.1	MC11g1060.1	mRNA

GO Annotation

GO Assignments

This gene is annotated with the following GO terms.

Category	Term Accession	Term Name
molecular_function	GO:0033897	ribonuclease T2 activity
molecular_function	GO:0003723	RNA binding