
MC11g0904 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.AAATTTGTATCAACAATGGGCAAGATGGTTGTTGCTTTGCTCCTCCTTTTGGCCCTCATGCTTTCCATCAATGGTAATTAATCTCATCTTCCCCACCCGATTTGTCATCAAATACTCGATTATTCTATCTCGATGAGTCTATTTATATTGTACTTGATCACAAATAAGTTGATTCCACAAATATTATAAGTCTCAAGTATAAGCTCCTACTTATTCGTGTGAGATGTAATATTTCATTTTTCGTTTTTGTGACTTTGGGGAACAGAAAATCGAGTGGCGGTAGAGGCAAAGATATGCGAGAAGCGGAGCAAGACGTGGTCGGGGTGGTGCGGGAACACGAGCCACTGCGACAGGCAATGCAAGAATTGGGAAGGTGCCAAGCATGGAGCTTGCCATGCCCAATTCCCTGGAAGAGCTTGTTTTTGCTACTTCAACTGT AAATTTGTATCAACAATGGGCAAGATGGTTGTTGCTTTGCTCCTCCTTTTGGCCCTCATGCTTTCCATCAATGAAAATCGAGTGGCGGTAGAGGCAAAGATATGCGAGAAGCGGAGCAAGACGTGGTCGGGGTGGTGCGGGAACACGAGCCACTGCGACAGGCAATGCAAGAATTGGGAAGGTGCCAAGCATGGAGCTTGCCATGCCCAATTCCCTGGAAGAGCTTGTTTTTGCTACTTCAACTGT AAATTTGTATCAACAATGGGCAAGATGGTTGTTGCTTTGCTCCTCCTTTTGGCCCTCATGCTTTCCATCAATGAAAATCGAGTGGCGGTAGAGGCAAAGATATGCGAGAAGCGGAGCAAGACGTGGTCGGGGTGGTGCGGGAACACGAGCCACTGCGACAGGCAATGCAAGAATTGGGAAGGTGCCAAGCATGGAGCTTGCCATGCCCAATTCCCTGGAAGAGCTTGTTTTTGCTACTTCAACTGT KFVSTMGKMVVALLLLLALMLSINENRVAVEAKICEKRSKTWSGWCGNTSHCDRQCKNWEGAKHGACHAQFPGRACFCYFNC Homology
BLAST of MC11g0904 vs. ExPASy Swiss-Prot
Match: P82787 (Defensin-like protein 19 OS=Arabidopsis thaliana OX=3702 GN=PDF1.4 PE=3 SV=2) HSP 1 Score: 105.9 bits (263), Expect = 2.2e-22 Identity = 46/70 (65.71%), Postives = 54/70 (77.14%), Query Frame = 0
BLAST of MC11g0904 vs. ExPASy Swiss-Prot
Match: P0C8Y4 (Defensin-like protein 1 OS=Dahlia merckii OX=43367 PE=1 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 2.8e-17 Identity = 35/50 (70.00%), Postives = 39/50 (78.00%), Query Frame = 0
BLAST of MC11g0904 vs. ExPASy Swiss-Prot
Match: Q7M1F2 (Defensin-like protein 1 OS=Clitoria ternatea OX=43366 PE=1 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 1.3e-14 Identity = 32/49 (65.31%), Postives = 38/49 (77.55%), Query Frame = 0
BLAST of MC11g0904 vs. ExPASy Swiss-Prot
Match: P22357 (Anther-specific protein SF18 (Fragment) OS=Helianthus annuus OX=4232 PE=2 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 4.9e-14 Identity = 32/53 (60.38%), Postives = 38/53 (71.70%), Query Frame = 0
BLAST of MC11g0904 vs. ExPASy Swiss-Prot
Match: Q7M1F3 (Defensin-like protein 1 OS=Aesculus hippocastanum OX=43364 PE=1 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.4e-13 Identity = 30/47 (63.83%), Postives = 37/47 (78.72%), Query Frame = 0
BLAST of MC11g0904 vs. NCBI nr
Match: XP_022139709.1 (defensin-like protein 1 [Momordica charantia]) HSP 1 Score: 167 bits (423), Expect = 3.15e-52 Identity = 77/77 (100.00%), Postives = 77/77 (100.00%), Query Frame = 0
BLAST of MC11g0904 vs. NCBI nr
Match: XP_038900009.1 (defensin-like protein 1 [Benincasa hispida]) HSP 1 Score: 150 bits (379), Expect = 2.01e-45 Identity = 68/82 (82.93%), Postives = 73/82 (89.02%), Query Frame = 0
BLAST of MC11g0904 vs. NCBI nr
Match: XP_004150110.1 (defensin-like protein 1 [Cucumis sativus] >KGN59894.1 hypothetical protein Csa_001866 [Cucumis sativus]) HSP 1 Score: 149 bits (376), Expect = 5.76e-45 Identity = 66/82 (80.49%), Postives = 71/82 (86.59%), Query Frame = 0
BLAST of MC11g0904 vs. NCBI nr
Match: XP_022976615.1 (defensin-like protein 1 [Cucurbita maxima]) HSP 1 Score: 146 bits (369), Expect = 6.74e-44 Identity = 65/82 (79.27%), Postives = 70/82 (85.37%), Query Frame = 0
BLAST of MC11g0904 vs. NCBI nr
Match: XP_008454663.1 (PREDICTED: defensin-like protein 1 [Cucumis melo] >KAA0036859.1 defensin-like protein 1 [Cucumis melo var. makuwa] >TYJ95923.1 defensin-like protein 1 [Cucumis melo var. makuwa]) HSP 1 Score: 145 bits (367), Expect = 1.36e-43 Identity = 64/82 (78.05%), Postives = 70/82 (85.37%), Query Frame = 0
BLAST of MC11g0904 vs. ExPASy TrEMBL
Match: A0A6J1CDS6 (defensin-like protein 1 OS=Momordica charantia OX=3673 GN=LOC111010557 PE=4 SV=1) HSP 1 Score: 167 bits (423), Expect = 1.52e-52 Identity = 77/77 (100.00%), Postives = 77/77 (100.00%), Query Frame = 0
BLAST of MC11g0904 vs. ExPASy TrEMBL
Match: A0A0A0LFX9 (Knot1 domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_3G851940 PE=4 SV=1) HSP 1 Score: 149 bits (376), Expect = 2.79e-45 Identity = 66/82 (80.49%), Postives = 71/82 (86.59%), Query Frame = 0
BLAST of MC11g0904 vs. ExPASy TrEMBL
Match: A0A6J1IJY9 (defensin-like protein 1 OS=Cucurbita maxima OX=3661 GN=LOC111476957 PE=4 SV=1) HSP 1 Score: 146 bits (369), Expect = 3.26e-44 Identity = 65/82 (79.27%), Postives = 70/82 (85.37%), Query Frame = 0
BLAST of MC11g0904 vs. ExPASy TrEMBL
Match: A0A5A7T656 (Defensin-like protein 1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold110G002350 PE=4 SV=1) HSP 1 Score: 145 bits (367), Expect = 6.59e-44 Identity = 64/82 (78.05%), Postives = 70/82 (85.37%), Query Frame = 0
BLAST of MC11g0904 vs. ExPASy TrEMBL
Match: A0A1S3BZX7 (defensin-like protein 1 OS=Cucumis melo OX=3656 GN=LOC103495015 PE=4 SV=1) HSP 1 Score: 145 bits (367), Expect = 6.59e-44 Identity = 64/82 (78.05%), Postives = 70/82 (85.37%), Query Frame = 0
BLAST of MC11g0904 vs. TAIR 10
Match: AT1G19610.1 (Arabidopsis defensin-like protein ) HSP 1 Score: 105.9 bits (263), Expect = 1.6e-23 Identity = 46/70 (65.71%), Postives = 54/70 (77.14%), Query Frame = 0
BLAST of MC11g0904 vs. TAIR 10
Match: AT2G26010.1 (plant defensin 1.3 ) HSP 1 Score: 73.2 bits (178), Expect = 1.1e-13 Identity = 35/74 (47.30%), Postives = 46/74 (62.16%), Query Frame = 0
BLAST of MC11g0904 vs. TAIR 10
Match: AT2G26020.1 (plant defensin 1.2b ) HSP 1 Score: 70.1 bits (170), Expect = 9.4e-13 Identity = 40/83 (48.19%), Postives = 48/83 (57.83%), Query Frame = 0
BLAST of MC11g0904 vs. TAIR 10
Match: AT5G44420.1 (plant defensin 1.2 ) HSP 1 Score: 69.7 bits (169), Expect = 1.2e-12 Identity = 39/83 (46.99%), Postives = 48/83 (57.83%), Query Frame = 0
BLAST of MC11g0904 vs. TAIR 10
Match: AT5G44430.1 (plant defensin 1.2C ) HSP 1 Score: 69.3 bits (168), Expect = 1.6e-12 Identity = 34/74 (45.95%), Postives = 44/74 (59.46%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|