
MC11g0274 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGACATTCAAACGTGTGGAATTCACATCCAAAGAACTACGGACCCGGTTCTCGGACTTGGTATGTCTTCTCCTCTATCTCAATTTTGCATCTTCACCCGAATATGCCCCTCTTCACATTGGATTTTGATTATGAACCATGTTCAACGGCTGCCCTTTTAACTGTTCATGTAATTGAGATCTTACTGGCTCGGATTTCAGAGGAATTCGTTTAATTACCGTCGCGTTCGGCACAGATTACATGGTTCTCATAAGCAGAAACGAAATCGAAAAAATTAAGCTGATTTTCGAATGTGGCTGTATGCCGGTTTCCAATGAACTATTAATCTCCATCTTAACATCTGTGAGCTTGTTATTTGCCAGCCGAGTCTGCGGGAACCCCCATGGATTGATCCGCAAGTATGGTCTGATGTGCTGTAGGCAGTGCTTCCGTAGTAACGCCAAAGAAATTGGCTTCATTAAGGTAATT ATGGGACATTCAAACGTGTGGAATTCACATCCAAAGAACTACGGACCCGGTTCTCGGACTTGCCGAGTCTGCGGGAACCCCCATGGATTGATCCGCAAGTATGGTCTGATGTGCTGTAGGCAGTGCTTCCGTAGTAACGCCAAAGAAATTGGCTTCATTAAGGTAATT ATGGGACATTCAAACGTGTGGAATTCACATCCAAAGAACTACGGACCCGGTTCTCGGACTTGCCGAGTCTGCGGGAACCCCCATGGATTGATCCGCAAGTATGGTCTGATGTGCTGTAGGCAGTGCTTCCGTAGTAACGCCAAAGAAATTGGCTTCATTAAGGTAATT MGHSNVWNSHPKNYGPGSRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKVI Homology
BLAST of MC11g0274 vs. ExPASy Swiss-Prot
Match: Q680P8 (40S ribosomal protein S29 OS=Arabidopsis thaliana OX=3702 GN=RPS29A PE=3 SV=2) HSP 1 Score: 116.7 bits (291), Expect = 8.5e-26 Identity = 50/54 (92.59%), Postives = 50/54 (92.59%), Query Frame = 0
BLAST of MC11g0274 vs. ExPASy Swiss-Prot
Match: Q5I7K3 (40S ribosomal protein S29 OS=Triticum aestivum OX=4565 GN=RPS29 PE=1 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 1.4e-25 Identity = 49/54 (90.74%), Postives = 51/54 (94.44%), Query Frame = 0
BLAST of MC11g0274 vs. ExPASy Swiss-Prot
Match: Q7XYB0 (40S ribosomal protein S29 OS=Griffithsia japonica OX=83288 GN=RPS29 PE=3 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 5.9e-19 Identity = 37/54 (68.52%), Postives = 44/54 (81.48%), Query Frame = 0
BLAST of MC11g0274 vs. ExPASy Swiss-Prot
Match: Q4PM47 (40S ribosomal protein S29 OS=Ixodes scapularis OX=6945 GN=RpS29 PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 2.9e-18 Identity = 38/55 (69.09%), Postives = 43/55 (78.18%), Query Frame = 0
BLAST of MC11g0274 vs. ExPASy Swiss-Prot
Match: Q6F473 (40S ribosomal protein S29 OS=Plutella xylostella OX=51655 GN=RpS29 PE=3 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 6.5e-18 Identity = 37/55 (67.27%), Postives = 43/55 (78.18%), Query Frame = 0
BLAST of MC11g0274 vs. NCBI nr
Match: OAY51010.1 (hypothetical protein MANES_05G180600v8 [Manihot esculenta]) HSP 1 Score: 127 bits (320), Expect = 3.19e-37 Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 0
BLAST of MC11g0274 vs. NCBI nr
Match: RXH87454.1 (hypothetical protein DVH24_034354 [Malus domestica]) HSP 1 Score: 127 bits (320), Expect = 3.36e-37 Identity = 55/56 (98.21%), Postives = 55/56 (98.21%), Query Frame = 0
BLAST of MC11g0274 vs. NCBI nr
Match: KAG8632675.1 (hypothetical protein MANES_18G044866v8 [Manihot esculenta]) HSP 1 Score: 127 bits (320), Expect = 3.45e-37 Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 0
BLAST of MC11g0274 vs. NCBI nr
Match: TQE05330.1 (hypothetical protein C1H46_009023 [Malus baccata]) HSP 1 Score: 127 bits (320), Expect = 3.74e-37 Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 0
BLAST of MC11g0274 vs. NCBI nr
Match: KAG4907652.1 (hypothetical protein JHK86_056136 [Glycine max] >KAG5074954.1 hypothetical protein JHK84_056185 [Glycine max] >KAG5077611.1 hypothetical protein JHK82_056306 [Glycine max]) HSP 1 Score: 127 bits (320), Expect = 5.83e-37 Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 0
BLAST of MC11g0274 vs. ExPASy TrEMBL
Match: F6HXU9 (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VIT_09s0002g00970 PE=3 SV=1) HSP 1 Score: 127 bits (320), Expect = 1.55e-37 Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 0
BLAST of MC11g0274 vs. ExPASy TrEMBL
Match: A0A2C9VZV0 (Uncharacterized protein OS=Manihot esculenta OX=3983 GN=MANES_05G180600 PE=3 SV=1) HSP 1 Score: 127 bits (320), Expect = 1.55e-37 Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 0
BLAST of MC11g0274 vs. ExPASy TrEMBL
Match: A0A498IZC1 (Uncharacterized protein OS=Malus domestica OX=3750 GN=DVH24_034354 PE=3 SV=1) HSP 1 Score: 127 bits (320), Expect = 1.63e-37 Identity = 55/56 (98.21%), Postives = 55/56 (98.21%), Query Frame = 0
BLAST of MC11g0274 vs. ExPASy TrEMBL
Match: A0A540N498 (Uncharacterized protein OS=Malus baccata OX=106549 GN=C1H46_009023 PE=3 SV=1) HSP 1 Score: 127 bits (320), Expect = 1.81e-37 Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 0
BLAST of MC11g0274 vs. ExPASy TrEMBL
Match: A0A0S3T7T0 (Uncharacterized protein OS=Vigna angularis var. angularis OX=157739 GN=Vigan.10G248000 PE=3 SV=1) HSP 1 Score: 127 bits (320), Expect = 3.56e-37 Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 0
BLAST of MC11g0274 vs. TAIR 10
Match: AT3G43980.1 (Ribosomal protein S14p/S29e family protein ) HSP 1 Score: 116.7 bits (291), Expect = 6.0e-27 Identity = 50/54 (92.59%), Postives = 50/54 (92.59%), Query Frame = 0
BLAST of MC11g0274 vs. TAIR 10
Match: AT3G44010.1 (Ribosomal protein S14p/S29e family protein ) HSP 1 Score: 116.7 bits (291), Expect = 6.0e-27 Identity = 50/54 (92.59%), Postives = 50/54 (92.59%), Query Frame = 0
BLAST of MC11g0274 vs. TAIR 10
Match: AT4G33865.1 (Ribosomal protein S14p/S29e family protein ) HSP 1 Score: 116.7 bits (291), Expect = 6.0e-27 Identity = 50/54 (92.59%), Postives = 50/54 (92.59%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|