
MC10g1100 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TGGTGTGTAGCTAACGAGAATGCTGGTGCAGATAAGCTCCAAGCAGGGCTACAATATGCGTGTGGGGTGGGAGGTGCCGATTGTGGTCCGATCCAACCTGGTTCTAACTGCTTTAGCCCTAATACACTTGAGGCCCATGCTTCGTACGCTTTCAACAGCTATTACCAGAAAAAAGCTCGTGCAGCTGGGTCCTGTGATTTCGATGGAGCTGCGTACATCGTTAATCAACCTCCT TGGTGTGTAGCTAACGAGAATGCTGGTGCAGATAAGCTCCAAGCAGGGCTACAATATGCGTGTGGGGTGGGAGGTGCCGATTGTGGTCCGATCCAACCTGGTTCTAACTGCTTTAGCCCTAATACACTTGAGGCCCATGCTTCGTACGCTTTCAACAGCTATTACCAGAAAAAAGCTCGTGCAGCTGGGTCCTGTGATTTCGATGGAGCTGCGTACATCGTTAATCAACCTCCT TGGTGTGTAGCTAACGAGAATGCTGGTGCAGATAAGCTCCAAGCAGGGCTACAATATGCGTGTGGGGTGGGAGGTGCCGATTGTGGTCCGATCCAACCTGGTTCTAACTGCTTTAGCCCTAATACACTTGAGGCCCATGCTTCGTACGCTTTCAACAGCTATTACCAGAAAAAAGCTCGTGCAGCTGGGTCCTGTGATTTCGATGGAGCTGCGTACATCGTTAATCAACCTCCT WCVANENAGADKLQAGLQYACGVGGADCGPIQPGSNCFSPNTLEAHASYAFNSYYQKKARAAGSCDFDGAAYIVNQPP Homology
BLAST of MC10g1100 vs. ExPASy Swiss-Prot
Match: O65399 (Glucan endo-1,3-beta-glucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=At1g11820 PE=2 SV=3) HSP 1 Score: 95.5 bits (236), Expect = 2.8e-19 Identity = 41/78 (52.56%), Postives = 54/78 (69.23%), Query Frame = 0
BLAST of MC10g1100 vs. ExPASy Swiss-Prot
Match: Q94CD8 (Glucan endo-1,3-beta-glucosidase 4 OS=Arabidopsis thaliana OX=3702 GN=At3g13560 PE=2 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 5.3e-18 Identity = 41/78 (52.56%), Postives = 52/78 (66.67%), Query Frame = 0
BLAST of MC10g1100 vs. ExPASy Swiss-Prot
Match: Q84V39 (Major pollen allergen Ole e 10 OS=Olea europaea OX=4146 PE=1 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 2.9e-16 Identity = 38/78 (48.72%), Postives = 45/78 (57.69%), Query Frame = 0
BLAST of MC10g1100 vs. ExPASy Swiss-Prot
Match: Q8VYE5 (Glucan endo-1,3-beta-glucosidase 12 OS=Arabidopsis thaliana OX=3702 GN=At4g29360 PE=2 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 2.9e-16 Identity = 35/78 (44.87%), Postives = 51/78 (65.38%), Query Frame = 0
BLAST of MC10g1100 vs. ExPASy Swiss-Prot
Match: Q94G86 (Glucan endo-1,3-beta-D-glucosidase OS=Olea europaea OX=4146 GN=OLE9 PE=1 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 3.8e-16 Identity = 38/78 (48.72%), Postives = 46/78 (58.97%), Query Frame = 0
BLAST of MC10g1100 vs. NCBI nr
Match: XP_022159039.1 (glucan endo-1,3-beta-glucosidase 12-like isoform X1 [Momordica charantia]) HSP 1 Score: 172 bits (435), Expect = 1.74e-49 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of MC10g1100 vs. NCBI nr
Match: XP_022159040.1 (glucan endo-1,3-beta-D-glucosidase-like isoform X2 [Momordica charantia]) HSP 1 Score: 172 bits (435), Expect = 1.17e-48 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of MC10g1100 vs. NCBI nr
Match: XP_022159041.1 (glucan endo-1,3-beta-glucosidase 12-like isoform X3 [Momordica charantia]) HSP 1 Score: 160 bits (405), Expect = 3.74e-45 Identity = 72/78 (92.31%), Postives = 73/78 (93.59%), Query Frame = 0
BLAST of MC10g1100 vs. NCBI nr
Match: XP_022157637.1 (glucan endo-1,3-beta-D-glucosidase-like isoform X2 [Momordica charantia]) HSP 1 Score: 160 bits (404), Expect = 9.86e-44 Identity = 70/78 (89.74%), Postives = 76/78 (97.44%), Query Frame = 0
BLAST of MC10g1100 vs. NCBI nr
Match: XP_022157636.1 (glucan endo-1,3-beta-D-glucosidase-like isoform X1 [Momordica charantia]) HSP 1 Score: 160 bits (404), Expect = 1.75e-43 Identity = 70/78 (89.74%), Postives = 76/78 (97.44%), Query Frame = 0
BLAST of MC10g1100 vs. ExPASy TrEMBL
Match: A0A6J1E172 ((1->3)-beta-glucan endohydrolase OS=Momordica charantia OX=3673 GN=LOC111025481 PE=3 SV=1) HSP 1 Score: 172 bits (435), Expect = 8.42e-50 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of MC10g1100 vs. ExPASy TrEMBL
Match: A0A6J1DXI4 ((1->3)-beta-glucan endohydrolase OS=Momordica charantia OX=3673 GN=LOC111025481 PE=3 SV=1) HSP 1 Score: 172 bits (435), Expect = 5.66e-49 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of MC10g1100 vs. ExPASy TrEMBL
Match: A0A6J1E2Q5 ((1->3)-beta-glucan endohydrolase OS=Momordica charantia OX=3673 GN=LOC111025481 PE=3 SV=1) HSP 1 Score: 160 bits (405), Expect = 1.81e-45 Identity = 72/78 (92.31%), Postives = 73/78 (93.59%), Query Frame = 0
BLAST of MC10g1100 vs. ExPASy TrEMBL
Match: A0A6J1DV03 ((1->3)-beta-glucan endohydrolase OS=Momordica charantia OX=3673 GN=LOC111024298 PE=3 SV=1) HSP 1 Score: 160 bits (404), Expect = 4.77e-44 Identity = 70/78 (89.74%), Postives = 76/78 (97.44%), Query Frame = 0
BLAST of MC10g1100 vs. ExPASy TrEMBL
Match: A0A6J1DYS1 ((1->3)-beta-glucan endohydrolase OS=Momordica charantia OX=3673 GN=LOC111024298 PE=3 SV=1) HSP 1 Score: 160 bits (404), Expect = 8.47e-44 Identity = 70/78 (89.74%), Postives = 76/78 (97.44%), Query Frame = 0
BLAST of MC10g1100 vs. TAIR 10
Match: AT2G05790.1 (O-Glycosyl hydrolases family 17 protein ) HSP 1 Score: 134.4 bits (337), Expect = 3.9e-32 Identity = 59/78 (75.64%), Postives = 68/78 (87.18%), Query Frame = 0
BLAST of MC10g1100 vs. TAIR 10
Match: AT5G55180.1 (O-Glycosyl hydrolases family 17 protein ) HSP 1 Score: 124.8 bits (312), Expect = 3.1e-29 Identity = 54/78 (69.23%), Postives = 63/78 (80.77%), Query Frame = 0
BLAST of MC10g1100 vs. TAIR 10
Match: AT5G55180.2 (O-Glycosyl hydrolases family 17 protein ) HSP 1 Score: 124.8 bits (312), Expect = 3.1e-29 Identity = 54/78 (69.23%), Postives = 63/78 (80.77%), Query Frame = 0
BLAST of MC10g1100 vs. TAIR 10
Match: AT4G26830.1 (O-Glycosyl hydrolases family 17 protein ) HSP 1 Score: 115.9 bits (289), Expect = 1.4e-26 Identity = 50/78 (64.10%), Postives = 59/78 (75.64%), Query Frame = 0
BLAST of MC10g1100 vs. TAIR 10
Match: AT2G30933.1 (Carbohydrate-binding X8 domain superfamily protein ) HSP 1 Score: 101.3 bits (251), Expect = 3.6e-22 Identity = 46/78 (58.97%), Postives = 54/78 (69.23%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|