
MC10g0383 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TCCAGGAATTTGGGAGAACTGGGATGTACACAGTCTCTTCTGCCCATGCACGGCATCATGGGTGCTACCTGCCTGACATCCCACCTCTGTGTTAGCGCACGGGCCTTTTGCGAGCTGTCTCATGGTACCTTCTGCCGTACTTGTCAGGATCGC TCCAGGAATTTGGGAGAACTGGGATGTACACAGTCTCTTCTGCCCATGCACGGCATCATGGGTGCTACCTGCCTGACATCCCACCTCTGTGTTAGCGCACGGGCCTTTTGCGAGCTGTCTCATGGTACCTTCTGCCGTACTTGTCAGGATCGC TCCAGGAATTTGGGAGAACTGGGATGTACACAGTCTCTTCTGCCCATGCACGGCATCATGGGTGCTACCTGCCTGACATCCCACCTCTGTGTTAGCGCACGGGCCTTTTGCGAGCTGTCTCATGGTACCTTCTGCCGTACTTGTCAGGATCGC SRNLGELGCTQSLLPMHGIMGATCLTSHLCVSARAFCELSHGTFCRTCQDR Homology
BLAST of MC10g0383 vs. NCBI nr
Match: XP_022149347.1 (uncharacterized protein LOC111017781 isoform X1 [Momordica charantia] >XP_022149348.1 uncharacterized protein LOC111017781 isoform X1 [Momordica charantia]) HSP 1 Score: 114 bits (284), Expect = 2.77e-31 Identity = 51/51 (100.00%), Postives = 51/51 (100.00%), Query Frame = 0
BLAST of MC10g0383 vs. NCBI nr
Match: XP_038882967.1 (uncharacterized protein LOC120074027 isoform X1 [Benincasa hispida]) HSP 1 Score: 111 bits (278), Expect = 2.34e-30 Identity = 50/51 (98.04%), Postives = 50/51 (98.04%), Query Frame = 0
BLAST of MC10g0383 vs. NCBI nr
Match: XP_022922830.1 (uncharacterized protein LOC111430696 isoform X1 [Cucurbita moschata]) HSP 1 Score: 111 bits (278), Expect = 4.69e-30 Identity = 50/51 (98.04%), Postives = 50/51 (98.04%), Query Frame = 0
BLAST of MC10g0383 vs. NCBI nr
Match: XP_022984255.1 (uncharacterized protein LOC111482625 isoform X1 [Cucurbita maxima]) HSP 1 Score: 110 bits (274), Expect = 9.52e-30 Identity = 49/51 (96.08%), Postives = 49/51 (96.08%), Query Frame = 0
BLAST of MC10g0383 vs. NCBI nr
Match: XP_023551739.1 (uncharacterized protein LOC111809622 isoform X2 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 104 bits (260), Expect = 1.30e-27 Identity = 47/51 (92.16%), Postives = 47/51 (92.16%), Query Frame = 0
BLAST of MC10g0383 vs. ExPASy TrEMBL
Match: A0A6J1D7P5 (uncharacterized protein LOC111017781 isoform X1 OS=Momordica charantia OX=3673 GN=LOC111017781 PE=4 SV=1) HSP 1 Score: 114 bits (284), Expect = 1.34e-31 Identity = 51/51 (100.00%), Postives = 51/51 (100.00%), Query Frame = 0
BLAST of MC10g0383 vs. ExPASy TrEMBL
Match: A0A6J1E9X4 (uncharacterized protein LOC111430696 isoform X1 OS=Cucurbita moschata OX=3662 GN=LOC111430696 PE=4 SV=1) HSP 1 Score: 111 bits (278), Expect = 2.27e-30 Identity = 50/51 (98.04%), Postives = 50/51 (98.04%), Query Frame = 0
BLAST of MC10g0383 vs. ExPASy TrEMBL
Match: A0A6J1J861 (uncharacterized protein LOC111482625 isoform X1 OS=Cucurbita maxima OX=3661 GN=LOC111482625 PE=4 SV=1) HSP 1 Score: 110 bits (274), Expect = 4.61e-30 Identity = 49/51 (96.08%), Postives = 49/51 (96.08%), Query Frame = 0
BLAST of MC10g0383 vs. ExPASy TrEMBL
Match: A0A6J1FMT0 (uncharacterized protein LOC111446884 isoform X1 OS=Cucurbita moschata OX=3662 GN=LOC111446884 PE=4 SV=1) HSP 1 Score: 100 bits (250), Expect = 2.04e-26 Identity = 47/51 (92.16%), Postives = 48/51 (94.12%), Query Frame = 0
BLAST of MC10g0383 vs. ExPASy TrEMBL
Match: A0A6J1D5H0 (uncharacterized protein LOC111017781 isoform X3 OS=Momordica charantia OX=3673 GN=LOC111017781 PE=4 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 4.46e-24 Identity = 43/43 (100.00%), Postives = 43/43 (100.00%), Query Frame = 0
BLAST of MC10g0383 vs. TAIR 10
Match: AT2G15000.4 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT4G34265.2); Has 80 Blast hits to 80 proteins in 11 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 80; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 76.3 bits (186), Expect = 8.2e-15 Identity = 35/51 (68.63%), Postives = 42/51 (82.35%), Query Frame = 0
BLAST of MC10g0383 vs. TAIR 10
Match: AT2G15000.5 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT4G34265.2); Has 80 Blast hits to 80 proteins in 11 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 80; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 76.3 bits (186), Expect = 8.2e-15 Identity = 35/51 (68.63%), Postives = 42/51 (82.35%), Query Frame = 0
BLAST of MC10g0383 vs. TAIR 10
Match: AT4G34265.2 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G15000.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). ) HSP 1 Score: 62.8 bits (151), Expect = 9.4e-11 Identity = 28/42 (66.67%), Postives = 35/42 (83.33%), Query Frame = 0
BLAST of MC10g0383 vs. TAIR 10
Match: AT2G15000.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT4G34265.2); Has 70 Blast hits to 70 proteins in 9 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 70; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 62.0 bits (149), Expect = 1.6e-10 Identity = 28/43 (65.12%), Postives = 35/43 (81.40%), Query Frame = 0
BLAST of MC10g0383 vs. TAIR 10
Match: AT4G34265.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G15000.3); Has 76 Blast hits to 76 proteins in 9 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 76; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 60.8 bits (146), Expect = 3.6e-10 Identity = 27/41 (65.85%), Postives = 34/41 (82.93%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|