MC08g2520 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGCCGTTGCTGTGCTGGCCGAGACGACAAGAAACTTAGCGGCGGCGTATCCAATGGAGCTTCTATTTGACCTGGACATGGTTCTCTCCGGCGACGACGACTTCGGTTGCTGCCACGTCACCGCGGCTAATTCCTCCGATTCTATTGTAGCGGATTTGCCGACGGTGGTGGCCGACGTTTGCGCCGTTTGCTTCGAGGATTTCCGGTCAGACGAGGGCGGAAAGCAAATCCCCTGCGGACACGTGTACCATGAGCCTTGCATCTCCTCCTGGCTCGCAGTCGCCGACTGCTGCCCCCTCTGCCGCCGCCGAGTG ATGGCTGCCGTTGCTGTGCTGGCCGAGACGACAAGAAACTTAGCGGCGGCGTATCCAATGGAGCTTCTATTTGACCTGGACATGGTTCTCTCCGGCGACGACGACTTCGGTTGCTGCCACGTCACCGCGGCTAATTCCTCCGATTCTATTGTAGCGGATTTGCCGACGGTGGTGGCCGACGTTTGCGCCGTTTGCTTCGAGGATTTCCGGTCAGACGAGGGCGGAAAGCAAATCCCCTGCGGACACGTGTACCATGAGCCTTGCATCTCCTCCTGGCTCGCAGTCGCCGACTGCTGCCCCCTCTGCCGCCGCCGAGTG ATGGCTGCCGTTGCTGTGCTGGCCGAGACGACAAGAAACTTAGCGGCGGCGTATCCAATGGAGCTTCTATTTGACCTGGACATGGTTCTCTCCGGCGACGACGACTTCGGTTGCTGCCACGTCACCGCGGCTAATTCCTCCGATTCTATTGTAGCGGATTTGCCGACGGTGGTGGCCGACGTTTGCGCCGTTTGCTTCGAGGATTTCCGGTCAGACGAGGGCGGAAAGCAAATCCCCTGCGGACACGTGTACCATGAGCCTTGCATCTCCTCCTGGCTCGCAGTCGCCGACTGCTGCCCCCTCTGCCGCCGCCGAGTG MAAVAVLAETTRNLAAAYPMELLFDLDMVLSGDDDFGCCHVTAANSSDSIVADLPTVVADVCAVCFEDFRSDEGGKQIPCGHVYHEPCISSWLAVADCCPLCRRRV Homology
BLAST of MC08g2520 vs. ExPASy Swiss-Prot
Match: Q9VHI7 (E3 ubiquitin-protein ligase Iruka OS=Drosophila melanogaster OX=7227 GN=Iru PE=1 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 4.7e-09 Identity = 20/43 (46.51%), Postives = 32/43 (74.42%), Query Frame = 0
BLAST of MC08g2520 vs. ExPASy Swiss-Prot
Match: P90990 (E3 ubiquitin-protein ligase trul-1 OS=Caenorhabditis elegans OX=6239 GN=trul-1 PE=3 SV=3) HSP 1 Score: 60.5 bits (145), Expect = 1.4e-08 Identity = 22/45 (48.89%), Postives = 29/45 (64.44%), Query Frame = 0
BLAST of MC08g2520 vs. ExPASy Swiss-Prot
Match: Q9ZV51 (RING-H2 finger protein ATL56 OS=Arabidopsis thaliana OX=3702 GN=ATL56 PE=2 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 2.3e-08 Identity = 22/46 (47.83%), Postives = 30/46 (65.22%), Query Frame = 0
BLAST of MC08g2520 vs. ExPASy Swiss-Prot
Match: P0CH30 (E3 ubiquitin-protein ligase RING1 OS=Gossypium hirsutum OX=3635 GN=RING1 PE=1 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 4.0e-08 Identity = 20/45 (44.44%), Postives = 29/45 (64.44%), Query Frame = 0
BLAST of MC08g2520 vs. ExPASy Swiss-Prot
Match: O22283 (Probable E3 ubiquitin-protein ligase RHC2A OS=Arabidopsis thaliana OX=3702 GN=RHC2A PE=2 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 5.2e-08 Identity = 20/45 (44.44%), Postives = 29/45 (64.44%), Query Frame = 0
BLAST of MC08g2520 vs. NCBI nr
Match: XP_022154667.1 (E3 ubiquitin-protein ligase RHA1B-like [Momordica charantia]) HSP 1 Score: 223 bits (568), Expect = 2.31e-73 Identity = 106/106 (100.00%), Postives = 106/106 (100.00%), Query Frame = 0
BLAST of MC08g2520 vs. NCBI nr
Match: XP_022946863.1 (E3 ubiquitin-protein ligase RING1-like [Cucurbita moschata]) HSP 1 Score: 179 bits (455), Expect = 3.96e-56 Identity = 86/103 (83.50%), Postives = 92/103 (89.32%), Query Frame = 0
BLAST of MC08g2520 vs. NCBI nr
Match: KAG6599476.1 (E3 ubiquitin-protein ligase RING1-like protein, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 179 bits (455), Expect = 3.96e-56 Identity = 86/103 (83.50%), Postives = 92/103 (89.32%), Query Frame = 0
BLAST of MC08g2520 vs. NCBI nr
Match: KAG7030453.1 (E3 ubiquitin-protein ligase RING1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 179 bits (455), Expect = 1.21e-55 Identity = 86/103 (83.50%), Postives = 92/103 (89.32%), Query Frame = 0
BLAST of MC08g2520 vs. NCBI nr
Match: XP_023545409.1 (E3 ubiquitin-protein ligase RING1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 178 bits (451), Expect = 1.61e-55 Identity = 85/103 (82.52%), Postives = 91/103 (88.35%), Query Frame = 0
BLAST of MC08g2520 vs. ExPASy TrEMBL
Match: A0A6J1DM93 (E3 ubiquitin-protein ligase RHA1B-like OS=Momordica charantia OX=3673 GN=LOC111021870 PE=4 SV=1) HSP 1 Score: 223 bits (568), Expect = 1.12e-73 Identity = 106/106 (100.00%), Postives = 106/106 (100.00%), Query Frame = 0
BLAST of MC08g2520 vs. ExPASy TrEMBL
Match: A0A6J1G511 (E3 ubiquitin-protein ligase RING1-like OS=Cucurbita moschata OX=3662 GN=LOC111450796 PE=4 SV=1) HSP 1 Score: 179 bits (455), Expect = 1.92e-56 Identity = 86/103 (83.50%), Postives = 92/103 (89.32%), Query Frame = 0
BLAST of MC08g2520 vs. ExPASy TrEMBL
Match: A0A0A0LKR7 (RING-type domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_2G000930 PE=4 SV=1) HSP 1 Score: 158 bits (399), Expect = 5.99e-48 Identity = 75/103 (72.82%), Postives = 80/103 (77.67%), Query Frame = 0
BLAST of MC08g2520 vs. ExPASy TrEMBL
Match: A0A5A7V2P4 (RING-H2 finger protein ATL5-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold332G00540 PE=4 SV=1) HSP 1 Score: 150 bits (379), Expect = 6.88e-45 Identity = 74/104 (71.15%), Postives = 79/104 (75.96%), Query Frame = 0
BLAST of MC08g2520 vs. ExPASy TrEMBL
Match: A0A1S4DZX3 (RING-H2 finger protein ATL5-like OS=Cucumis melo OX=3656 GN=LOC107991276 PE=4 SV=1) HSP 1 Score: 150 bits (379), Expect = 6.88e-45 Identity = 74/104 (71.15%), Postives = 79/104 (75.96%), Query Frame = 0
BLAST of MC08g2520 vs. TAIR 10
Match: AT1G68180.1 (RING/U-box superfamily protein ) HSP 1 Score: 63.5 bits (153), Expect = 1.1e-10 Identity = 26/57 (45.61%), Postives = 35/57 (61.40%), Query Frame = 0
BLAST of MC08g2520 vs. TAIR 10
Match: AT2G18670.1 (RING/U-box superfamily protein ) HSP 1 Score: 59.7 bits (143), Expect = 1.6e-09 Identity = 22/46 (47.83%), Postives = 30/46 (65.22%), Query Frame = 0
BLAST of MC08g2520 vs. TAIR 10
Match: AT3G60080.1 (RING/U-box superfamily protein ) HSP 1 Score: 59.7 bits (143), Expect = 1.6e-09 Identity = 22/43 (51.16%), Postives = 29/43 (67.44%), Query Frame = 0
BLAST of MC08g2520 vs. TAIR 10
Match: AT2G39720.1 (RING-H2 finger C2A ) HSP 1 Score: 58.5 bits (140), Expect = 3.7e-09 Identity = 20/45 (44.44%), Postives = 29/45 (64.44%), Query Frame = 0
BLAST of MC08g2520 vs. TAIR 10
Match: AT2G44330.1 (RING/U-box superfamily protein ) HSP 1 Score: 58.5 bits (140), Expect = 3.7e-09 Identity = 27/63 (42.86%), Postives = 37/63 (58.73%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|