MC08g2019 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.CTGAGCGGGAGGGGAGCTGCAGTCGGTATTGGAAACGTGTTCAGTTCTTTGATCCATTCCGTGGCGCGAAATCCATCATTGGCTAAACAATCATTTGGTTGTGCCATTTTGGGCTTTGCTCTAACCGAAGCTATTGCATCCTTTGCCCCCTTCTTCGCAAGTAAGCAACTGACATTTTTGATCTCATCCGTATTC CTGAGCGGGAGGGGAGCTGCAGTCGGTATTGGAAACGTGTTCAGTTCTTTGATCCATTCCGTGGCGCGAAATCCATCATTGGCTAAACAATCATTTGGTTGTGCCATTTTGGGCTTTGCTCTAACCGAAGCTATTGCATCCTTTGCCCCCTTCTTCGCAAGTAAGCAACTGACATTTTTGATCTCATCCGTATTC CTGAGCGGGAGGGGAGCTGCAGTCGGTATTGGAAACGTGTTCAGTTCTTTGATCCATTCCGTGGCGCGAAATCCATCATTGGCTAAACAATCATTTGGTTGTGCCATTTTGGGCTTTGCTCTAACCGAAGCTATTGCATCCTTTGCCCCCTTCTTCGCAAGTAAGCAACTGACATTTTTGATCTCATCCGTATTC LSGRGAAVGIGNVFSSLIHSVARNPSLAKQSFGCAILGFALTEAIASFAPFFASKQLTFLISSVF Homology
BLAST of MC08g2019 vs. ExPASy Swiss-Prot
Match: Q37550 (ATP synthase subunit 9, mitochondrial OS=Malus domestica OX=3750 GN=ATP9 PE=3 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 9.8e-18 Identity = 52/65 (80.00%), Postives = 55/65 (84.62%), Query Frame = 0
BLAST of MC08g2019 vs. ExPASy Swiss-Prot
Match: P17254 (ATP synthase subunit 9, mitochondrial OS=Helianthus annuus OX=4232 GN=ATP9 PE=3 SV=2) HSP 1 Score: 84.0 bits (206), Expect = 7.0e-16 Identity = 49/64 (76.56%), Postives = 52/64 (81.25%), Query Frame = 0
BLAST of MC08g2019 vs. ExPASy Swiss-Prot
Match: P60113 (ATP synthase subunit 9, mitochondrial OS=Brassica napus OX=3708 GN=ATP9 PE=2 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 1.2e-15 Identity = 49/65 (75.38%), Postives = 52/65 (80.00%), Query Frame = 0
BLAST of MC08g2019 vs. ExPASy Swiss-Prot
Match: P60118 (ATP synthase subunit 9, mitochondrial OS=Petunia hybrida OX=4102 GN=ATP9 PE=2 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 2.3e-14 Identity = 48/61 (78.69%), Postives = 49/61 (80.33%), Query Frame = 0
BLAST of MC08g2019 vs. ExPASy Swiss-Prot
Match: P60117 (ATP synthase subunit 9, mitochondrial OS=Solanum lycopersicum OX=4081 GN=ATP9 PE=3 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 2.3e-14 Identity = 48/61 (78.69%), Postives = 49/61 (80.33%), Query Frame = 0
BLAST of MC08g2019 vs. NCBI nr
Match: WP_131796660.1 (ATP synthase subunit C family protein [Candidatus Frankia datiscae]) HSP 1 Score: 101 bits (252), Expect = 1.45e-25 Identity = 54/57 (94.74%), Postives = 54/57 (94.74%), Query Frame = 0
BLAST of MC08g2019 vs. NCBI nr
Match: AKE34108.1 (ATP synthase subunit 9, partial [Fragaria chiloensis]) HSP 1 Score: 91.7 bits (226), Expect = 1.16e-22 Identity = 52/65 (80.00%), Postives = 55/65 (84.62%), Query Frame = 0
BLAST of MC08g2019 vs. NCBI nr
Match: YP_009241667.1 (ATPase subunit 9 [Ziziphus jujuba] >AMP43650.1 ATPase subunit 9 [Ziziphus jujuba]) HSP 1 Score: 92.0 bits (227), Expect = 1.18e-22 Identity = 53/65 (81.54%), Postives = 55/65 (84.62%), Query Frame = 0
BLAST of MC08g2019 vs. NCBI nr
Match: YP_002608407.1 (ATPase subunit 9 [Vitis vinifera] >ACS15186.1 ATPase subunit 9 [Vitis vinifera] >CAQ77677.1 ATPase subunit 9 [Vitis vinifera] >VZL70178.1 atp9 [Vitis riparia x Vitis cinerea]) HSP 1 Score: 91.7 bits (226), Expect = 1.63e-22 Identity = 52/65 (80.00%), Postives = 55/65 (84.62%), Query Frame = 0
BLAST of MC08g2019 vs. NCBI nr
Match: AHF22792.1 (ATP synthase subunit 9, partial [Fragaria iinumae] >AHF22793.1 ATP synthase subunit 9, partial [Fragaria mandshurica] >AHF22795.1 ATP synthase subunit 9, partial [Fragaria chiloensis] >AHF22796.1 ATP synthase subunit 9, partial [Fragaria virginiana] >AHF22797.1 ATP synthase subunit 9, partial [Fragaria vesca subsp. vesca] >AKE34106.1 ATP synthase subunit 9, partial [Fragaria vesca subsp. bracteata]) HSP 1 Score: 91.7 bits (226), Expect = 1.68e-22 Identity = 52/65 (80.00%), Postives = 55/65 (84.62%), Query Frame = 0
BLAST of MC08g2019 vs. ExPASy TrEMBL
Match: A0A0F6T772 (ATP synthase subunit 9, mitochondrial (Fragment) OS=Fragaria chiloensis OX=101007 GN=atp9 PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 5.62e-23 Identity = 52/65 (80.00%), Postives = 55/65 (84.62%), Query Frame = 0
BLAST of MC08g2019 vs. ExPASy TrEMBL
Match: A0A142BZ06 (ATP synthase subunit 9, mitochondrial OS=Ziziphus jujuba OX=326968 GN=atp9 PE=3 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 5.72e-23 Identity = 53/65 (81.54%), Postives = 55/65 (84.62%), Query Frame = 0
BLAST of MC08g2019 vs. ExPASy TrEMBL
Match: B6VJY9 (ATP synthase subunit 9, mitochondrial OS=Vitis vinifera OX=29760 GN=atp9 PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 7.91e-23 Identity = 52/65 (80.00%), Postives = 55/65 (84.62%), Query Frame = 0
BLAST of MC08g2019 vs. ExPASy TrEMBL
Match: A0A654ICJ0 (ATP synthase subunit 9, mitochondrial OS=Vitis riparia x Vitis cinerea OX=2018007 GN=atp9 PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 7.91e-23 Identity = 52/65 (80.00%), Postives = 55/65 (84.62%), Query Frame = 0
BLAST of MC08g2019 vs. ExPASy TrEMBL
Match: A0A0B4L0M8 (ATP synthase subunit 9, mitochondrial (Fragment) OS=Fragaria iinumae OX=64939 GN=atp9 PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 8.13e-23 Identity = 52/65 (80.00%), Postives = 55/65 (84.62%), Query Frame = 0
BLAST of MC08g2019 vs. TAIR 10
Match: AT2G07671.1 (ATP synthase subunit C family protein ) HSP 1 Score: 83.2 bits (204), Expect = 8.5e-17 Identity = 49/65 (75.38%), Postives = 52/65 (80.00%), Query Frame = 0
BLAST of MC08g2019 vs. TAIR 10
Match: ATMG01080.1 (mitochondrial F0-ATPase subunit 9 ) HSP 1 Score: 83.2 bits (204), Expect = 8.5e-17 Identity = 49/65 (75.38%), Postives = 52/65 (80.00%), Query Frame = 0
BLAST of MC08g2019 vs. TAIR 10
Match: ATMG00040.1 (ATP synthase subunit C family protein ) HSP 1 Score: 47.8 bits (112), Expect = 4.0e-06 Identity = 26/48 (54.17%), Postives = 34/48 (70.83%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|