
MC08g0449 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.CTAAAGGTTATGGAGCTTTCACCTCAGCAGCTGATCGCCTACAATGGCACCGACCCGTCGAAGCCCATCTATGTGGCTGTGAAGGGCCGCGTCTTCGACGTCACGACCGGGAGTTCTTTCTACGGCCCCGGCGGCGCTTACGCCATGTTCGCCGGCAAGGACGCGAGCAGAGCTCTGGCCAAGATGACCAAGAACGAGGAGGACATTATCTCTTCGCTCGATGGCCTCTCTGAGAAAGAGATCGGAGTTCTGAACGACTGGGAGAAGAAATTCGAAGCTAAGTACCCTATTGTTGGCCGTGTTGTT CTAAAGGTTATGGAGCTTTCACCTCAGCAGCTGATCGCCTACAATGGCACCGACCCGTCGAAGCCCATCTATGTGGCTGTGAAGGGCCGCGTCTTCGACGTCACGACCGGGAGTTCTTTCTACGGCCCCGGCGGCGCTTACGCCATGTTCGCCGGCAAGGACGCGAGCAGAGCTCTGGCCAAGATGACCAAGAACGAGGAGGACATTATCTCTTCGCTCGATGGCCTCTCTGAGAAAGAGATCGGAGTTCTGAACGACTGGGAGAAGAAATTCGAAGCTAAGTACCCTATTGTTGGCCGTGTTGTT CTAAAGGTTATGGAGCTTTCACCTCAGCAGCTGATCGCCTACAATGGCACCGACCCGTCGAAGCCCATCTATGTGGCTGTGAAGGGCCGCGTCTTCGACGTCACGACCGGGAGTTCTTTCTACGGCCCCGGCGGCGCTTACGCCATGTTCGCCGGCAAGGACGCGAGCAGAGCTCTGGCCAAGATGACCAAGAACGAGGAGGACATTATCTCTTCGCTCGATGGCCTCTCTGAGAAAGAGATCGGAGTTCTGAACGACTGGGAGAAGAAATTCGAAGCTAAGTACCCTATTGTTGGCCGTGTTGTT LKVMELSPQQLIAYNGTDPSKPIYVAVKGRVFDVTTGSSFYGPGGAYAMFAGKDASRALAKMTKNEEDIISSLDGLSEKEIGVLNDWEKKFEAKYPIVGRVV Homology
BLAST of MC08g0449 vs. ExPASy Swiss-Prot
Match: Q9SK39 (Probable steroid-binding protein 3 OS=Arabidopsis thaliana OX=3702 GN=MP3 PE=1 SV=1) HSP 1 Score: 160.6 bits (405), Expect = 9.3e-39 Identity = 76/99 (76.77%), Postives = 85/99 (85.86%), Query Frame = 0
BLAST of MC08g0449 vs. ExPASy Swiss-Prot
Match: Q9FVZ9 (Membrane steroid-binding protein 2 OS=Oryza sativa subsp. japonica OX=39947 GN=MSBP2 PE=2 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 7.6e-25 Identity = 50/101 (49.50%), Postives = 74/101 (73.27%), Query Frame = 0
BLAST of MC08g0449 vs. ExPASy Swiss-Prot
Match: Q9FVZ7 (Membrane steroid-binding protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=MSBP1 PE=1 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 5.0e-24 Identity = 51/97 (52.58%), Postives = 68/97 (70.10%), Query Frame = 0
BLAST of MC08g0449 vs. ExPASy Swiss-Prot
Match: Q9XFM6 (Membrane steroid-binding protein 1 OS=Arabidopsis thaliana OX=3702 GN=MSBP1 PE=1 SV=2) HSP 1 Score: 110.2 bits (274), Expect = 1.4e-23 Identity = 51/101 (50.50%), Postives = 72/101 (71.29%), Query Frame = 0
BLAST of MC08g0449 vs. ExPASy Swiss-Prot
Match: Q9M2Z4 (Membrane steroid-binding protein 2 OS=Arabidopsis thaliana OX=3702 GN=MSBP2 PE=1 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.2e-22 Identity = 47/97 (48.45%), Postives = 69/97 (71.13%), Query Frame = 0
BLAST of MC08g0449 vs. NCBI nr
Match: XP_022131551.1 (probable steroid-binding protein 3 [Momordica charantia]) HSP 1 Score: 198 bits (504), Expect = 6.37e-64 Identity = 99/99 (100.00%), Postives = 99/99 (100.00%), Query Frame = 0
BLAST of MC08g0449 vs. NCBI nr
Match: XP_022997574.1 (probable steroid-binding protein 3 [Cucurbita maxima]) HSP 1 Score: 189 bits (480), Expect = 2.92e-60 Identity = 93/99 (93.94%), Postives = 97/99 (97.98%), Query Frame = 0
BLAST of MC08g0449 vs. NCBI nr
Match: XP_022962142.1 (probable steroid-binding protein 3 [Cucurbita moschata] >KAG6598539.1 putative steroid-binding protein 3, partial [Cucurbita argyrosperma subsp. sororia] >KAG7029471.1 putative steroid-binding protein 3, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 186 bits (472), Expect = 4.85e-59 Identity = 92/99 (92.93%), Postives = 96/99 (96.97%), Query Frame = 0
BLAST of MC08g0449 vs. NCBI nr
Match: XP_023547192.1 (probable steroid-binding protein 3 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 184 bits (467), Expect = 2.81e-58 Identity = 91/99 (91.92%), Postives = 95/99 (95.96%), Query Frame = 0
BLAST of MC08g0449 vs. NCBI nr
Match: XP_021889359.1 (probable steroid-binding protein 3 [Carica papaya]) HSP 1 Score: 181 bits (460), Expect = 3.29e-57 Identity = 89/99 (89.90%), Postives = 94/99 (94.95%), Query Frame = 0
BLAST of MC08g0449 vs. ExPASy TrEMBL
Match: A0A6J1BPT6 (probable steroid-binding protein 3 OS=Momordica charantia OX=3673 GN=LOC111004708 PE=4 SV=1) HSP 1 Score: 198 bits (504), Expect = 3.08e-64 Identity = 99/99 (100.00%), Postives = 99/99 (100.00%), Query Frame = 0
BLAST of MC08g0449 vs. ExPASy TrEMBL
Match: A0A6J1KBX0 (probable steroid-binding protein 3 OS=Cucurbita maxima OX=3661 GN=LOC111492464 PE=4 SV=1) HSP 1 Score: 189 bits (480), Expect = 1.41e-60 Identity = 93/99 (93.94%), Postives = 97/99 (97.98%), Query Frame = 0
BLAST of MC08g0449 vs. ExPASy TrEMBL
Match: A0A6J1HBX6 (probable steroid-binding protein 3 OS=Cucurbita moschata OX=3662 GN=LOC111462683 PE=4 SV=1) HSP 1 Score: 186 bits (472), Expect = 2.35e-59 Identity = 92/99 (92.93%), Postives = 96/99 (96.97%), Query Frame = 0
BLAST of MC08g0449 vs. ExPASy TrEMBL
Match: M5XM79 (Cytochrome b5 heme-binding domain-containing protein OS=Prunus persica OX=3760 GN=PRUPE_1G396100 PE=4 SV=1) HSP 1 Score: 179 bits (455), Expect = 9.21e-57 Identity = 88/99 (88.89%), Postives = 92/99 (92.93%), Query Frame = 0
BLAST of MC08g0449 vs. ExPASy TrEMBL
Match: A0A314ZUT0 (Putative steroid-binding protein 3 OS=Prunus yedoensis var. nudiflora OX=2094558 GN=Pyn_08680 PE=4 SV=1) HSP 1 Score: 179 bits (455), Expect = 9.21e-57 Identity = 88/99 (88.89%), Postives = 92/99 (92.93%), Query Frame = 0
BLAST of MC08g0449 vs. TAIR 10
Match: AT2G24940.1 (membrane-associated progesterone binding protein 2 ) HSP 1 Score: 160.6 bits (405), Expect = 6.6e-40 Identity = 76/99 (76.77%), Postives = 85/99 (85.86%), Query Frame = 0
BLAST of MC08g0449 vs. TAIR 10
Match: AT5G52240.1 (membrane steroid binding protein 1 ) HSP 1 Score: 110.2 bits (274), Expect = 1.0e-24 Identity = 51/101 (50.50%), Postives = 72/101 (71.29%), Query Frame = 0
BLAST of MC08g0449 vs. TAIR 10
Match: AT5G52240.2 (membrane steroid binding protein 1 ) HSP 1 Score: 110.2 bits (274), Expect = 1.0e-24 Identity = 51/101 (50.50%), Postives = 72/101 (71.29%), Query Frame = 0
BLAST of MC08g0449 vs. TAIR 10
Match: AT3G48890.1 (membrane-associated progesterone binding protein 3 ) HSP 1 Score: 107.1 bits (266), Expect = 8.7e-24 Identity = 47/97 (48.45%), Postives = 69/97 (71.13%), Query Frame = 0
BLAST of MC08g0449 vs. TAIR 10
Match: AT4G14965.1 (membrane-associated progesterone binding protein 4 ) HSP 1 Score: 82.4 bits (202), Expect = 2.3e-16 Identity = 41/96 (42.71%), Postives = 54/96 (56.25%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|