MC07g0403 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TTGAGAAACTTGGCATCACAGAAAGCAGTAGTGATTTTTTCCAAGAGCTCATGCTACATATGTCATAGCGTCCAGACACTTTTTTATGAGCTTGGTGTGAGCCCTGCTATTCATGAGCTTGACCATGAAGCAAATGGGCGAGAAATTGATTGGGCTCTTAGAGGTCTAGGGTGCAACCCTTCTGTTCCAGCTGTGTTCATAGGAGGAAAGTTTATAGGTACATCAAAAGATGTTATTTCTCTCCATGTTAATGGGGACCTGAAACAAATGTTGATAGATGCGAAGGCCATCTGGTTG TTGAGAAACTTGGCATCACAGAAAGCAGTAGTGATTTTTTCCAAGAGCTCATGCTACATATGTCATAGCGTCCAGACACTTTTTTATGAGCTTGGTGTGAGCCCTGCTATTCATGAGCTTGACCATGAAGCAAATGGGCGAGAAATTGATTGGGCTCTTAGAGGTCTAGGGTGCAACCCTTCTGTTCCAGCTGTGTTCATAGGAGGAAAGTTTATAGGTACATCAAAAGATGTTATTTCTCTCCATGTTAATGGGGACCTGAAACAAATGTTGATAGATGCGAAGGCCATCTGGTTG TTGAGAAACTTGGCATCACAGAAAGCAGTAGTGATTTTTTCCAAGAGCTCATGCTACATATGTCATAGCGTCCAGACACTTTTTTATGAGCTTGGTGTGAGCCCTGCTATTCATGAGCTTGACCATGAAGCAAATGGGCGAGAAATTGATTGGGCTCTTAGAGGTCTAGGGTGCAACCCTTCTGTTCCAGCTGTGTTCATAGGAGGAAAGTTTATAGGTACATCAAAAGATGTTATTTCTCTCCATGTTAATGGGGACCTGAAACAAATGTTGATAGATGCGAAGGCCATCTGGTTG LRNLASQKAVVIFSKSSCYICHSVQTLFYELGVSPAIHELDHEANGREIDWALRGLGCNPSVPAVFIGGKFIGTSKDVISLHVNGDLKQMLIDAKAIWL Homology
BLAST of MC07g0403 vs. ExPASy Swiss-Prot
Match: Q9LYC6 (Glutaredoxin-C11 OS=Arabidopsis thaliana OX=3702 GN=GRXC11 PE=3 SV=1) HSP 1 Score: 146.4 bits (368), Expect = 1.8e-34 Identity = 68/100 (68.00%), Postives = 87/100 (87.00%), Query Frame = 0
BLAST of MC07g0403 vs. ExPASy Swiss-Prot
Match: O82254 (Putative glutaredoxin-C12 OS=Arabidopsis thaliana OX=3702 GN=GRXC12 PE=3 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 5.3e-31 Identity = 63/100 (63.00%), Postives = 83/100 (83.00%), Query Frame = 0
BLAST of MC07g0403 vs. ExPASy Swiss-Prot
Match: Q9LIF1 (Monothiol glutaredoxin-S10 OS=Arabidopsis thaliana OX=3702 GN=GRXS10 PE=3 SV=1) HSP 1 Score: 130.6 bits (327), Expect = 1.0e-29 Identity = 58/96 (60.42%), Postives = 80/96 (83.33%), Query Frame = 0
BLAST of MC07g0403 vs. ExPASy Swiss-Prot
Match: O23421 (Monothiol glutaredoxin-S3 OS=Arabidopsis thaliana OX=3702 GN=GRXS3 PE=3 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 1.7e-24 Identity = 52/99 (52.53%), Postives = 75/99 (75.76%), Query Frame = 0
BLAST of MC07g0403 vs. ExPASy Swiss-Prot
Match: Q0JG89 (Putative glutaredoxin-C2 OS=Oryza sativa subsp. japonica OX=39947 GN=GRXC2 PE=3 SV=2) HSP 1 Score: 111.3 bits (277), Expect = 6.3e-24 Identity = 53/97 (54.64%), Postives = 74/97 (76.29%), Query Frame = 0
BLAST of MC07g0403 vs. NCBI nr
Match: XP_022146613.1 (glutaredoxin-C11 [Momordica charantia]) HSP 1 Score: 202 bits (515), Expect = 1.26e-65 Identity = 98/99 (98.99%), Postives = 98/99 (98.99%), Query Frame = 0
BLAST of MC07g0403 vs. NCBI nr
Match: XP_022954101.1 (glutaredoxin-C11-like [Cucurbita moschata] >XP_022992474.1 glutaredoxin-C11-like isoform X2 [Cucurbita maxima] >XP_023549403.1 glutaredoxin-C11-like [Cucurbita pepo subsp. pepo] >KAG6575856.1 Glutaredoxin-C11, partial [Cucurbita argyrosperma subsp. sororia] >KAG7014392.1 Glutaredoxin-C11, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 200 bits (508), Expect = 1.47e-64 Identity = 95/99 (95.96%), Postives = 98/99 (98.99%), Query Frame = 0
BLAST of MC07g0403 vs. NCBI nr
Match: XP_038876720.1 (glutaredoxin-C11 [Benincasa hispida]) HSP 1 Score: 199 bits (505), Expect = 4.21e-64 Identity = 94/99 (94.95%), Postives = 98/99 (98.99%), Query Frame = 0
BLAST of MC07g0403 vs. NCBI nr
Match: XP_008451630.1 (PREDICTED: glutaredoxin-C11 [Cucumis melo] >XP_031744239.1 glutaredoxin-C11 [Cucumis sativus] >KAA0068043.1 glutaredoxin-C11-like [Cucumis melo var. makuwa] >TYK18085.1 glutaredoxin-C11-like [Cucumis melo var. makuwa]) HSP 1 Score: 198 bits (504), Expect = 5.99e-64 Identity = 93/99 (93.94%), Postives = 98/99 (98.99%), Query Frame = 0
BLAST of MC07g0403 vs. NCBI nr
Match: KAE8646327.1 (hypothetical protein Csa_015602 [Cucumis sativus]) HSP 1 Score: 197 bits (501), Expect = 1.33e-61 Identity = 92/98 (93.88%), Postives = 97/98 (98.98%), Query Frame = 0
BLAST of MC07g0403 vs. ExPASy TrEMBL
Match: A0A6J1CZ09 (glutaredoxin-C11 OS=Momordica charantia OX=3673 GN=LOC111015770 PE=3 SV=1) HSP 1 Score: 202 bits (515), Expect = 6.08e-66 Identity = 98/99 (98.99%), Postives = 98/99 (98.99%), Query Frame = 0
BLAST of MC07g0403 vs. ExPASy TrEMBL
Match: A0A6J1JXM7 (glutaredoxin-C11-like isoform X2 OS=Cucurbita maxima OX=3661 GN=LOC111488793 PE=3 SV=1) HSP 1 Score: 200 bits (508), Expect = 7.11e-65 Identity = 95/99 (95.96%), Postives = 98/99 (98.99%), Query Frame = 0
BLAST of MC07g0403 vs. ExPASy TrEMBL
Match: A0A6J1GPY2 (glutaredoxin-C11-like OS=Cucurbita moschata OX=3662 GN=LOC111456468 PE=3 SV=1) HSP 1 Score: 200 bits (508), Expect = 7.11e-65 Identity = 95/99 (95.96%), Postives = 98/99 (98.99%), Query Frame = 0
BLAST of MC07g0403 vs. ExPASy TrEMBL
Match: A0A5A7VIX0 (Glutaredoxin-C11-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold411G00060 PE=3 SV=1) HSP 1 Score: 198 bits (504), Expect = 2.90e-64 Identity = 93/99 (93.94%), Postives = 98/99 (98.99%), Query Frame = 0
BLAST of MC07g0403 vs. ExPASy TrEMBL
Match: A0A0A0K7M4 (Glutaredoxin domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_7G394580 PE=3 SV=1) HSP 1 Score: 198 bits (504), Expect = 2.90e-64 Identity = 93/99 (93.94%), Postives = 98/99 (98.99%), Query Frame = 0
BLAST of MC07g0403 vs. TAIR 10
Match: AT3G62950.1 (Thioredoxin superfamily protein ) HSP 1 Score: 146.4 bits (368), Expect = 1.3e-35 Identity = 68/100 (68.00%), Postives = 87/100 (87.00%), Query Frame = 0
BLAST of MC07g0403 vs. TAIR 10
Match: AT2G47870.1 (Thioredoxin superfamily protein ) HSP 1 Score: 134.8 bits (338), Expect = 3.8e-32 Identity = 63/100 (63.00%), Postives = 83/100 (83.00%), Query Frame = 0
BLAST of MC07g0403 vs. TAIR 10
Match: AT3G21460.1 (Glutaredoxin family protein ) HSP 1 Score: 130.6 bits (327), Expect = 7.1e-31 Identity = 58/96 (60.42%), Postives = 80/96 (83.33%), Query Frame = 0
BLAST of MC07g0403 vs. TAIR 10
Match: AT4G15700.1 (Thioredoxin superfamily protein ) HSP 1 Score: 113.2 bits (282), Expect = 1.2e-25 Identity = 52/99 (52.53%), Postives = 75/99 (75.76%), Query Frame = 0
BLAST of MC07g0403 vs. TAIR 10
Match: AT4G15690.1 (Thioredoxin superfamily protein ) HSP 1 Score: 110.5 bits (275), Expect = 7.6e-25 Identity = 52/99 (52.53%), Postives = 73/99 (73.74%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|