MC07g0008 (gene) Bitter gourd (Dali-11) v1
|
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.CTAGAGTCTTATTTATGTAAGGAGATCGAAGATCGAATTAAGTCTCAAGAGGAGAATTGGTGTTTTACTACCAACCACAAATTTCATGTTGGCCCAAGTCTAGAGTCTTATTTATGTAAGGAGATCGAAGATCGAATTAAGTCTCAAGAGGAGAATTGGTGTTTTACTACCAACCACAAATTTCATGTTGGCCCAAGT CTAGAGTCTTATTTATGTAAGGAGATCGAAGATCGAATTAAGTCTCAAGAGGAGAATTGGTGTTTTACTACCAACCACAAATTTCATGTTGGCCCAAGT LESYLCKEIEDRIKSQEENWCFTTNHKFHVGPS Homology
BLAST of MC07g0008 vs. ExPASy Swiss-Prot
Match: Q4VZH1 (NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Cucumis sativus OX=3659 GN=ndhK PE=3 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 5.2e-07 Identity = 23/24 (95.83%), Postives = 23/24 (95.83%), Query Frame = 0
BLAST of MC07g0008 vs. ExPASy Swiss-Prot
Match: B0Z4L3 (NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Oenothera argillicola OX=3940 GN=ndhK PE=3 SV=1) HSP 1 Score: 52.4 bits (124), Expect = 1.2e-06 Identity = 22/24 (91.67%), Postives = 23/24 (95.83%), Query Frame = 0
BLAST of MC07g0008 vs. ExPASy Swiss-Prot
Match: B0Z4U7 (NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Oenothera biennis OX=3942 GN=ndhK PE=3 SV=1) HSP 1 Score: 52.4 bits (124), Expect = 1.2e-06 Identity = 22/24 (91.67%), Postives = 23/24 (95.83%), Query Frame = 0
BLAST of MC07g0008 vs. ExPASy Swiss-Prot
Match: Q9MTP4 (NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Oenothera elata subsp. hookeri OX=85636 GN=ndhK PE=3 SV=2) HSP 1 Score: 52.4 bits (124), Expect = 1.2e-06 Identity = 22/24 (91.67%), Postives = 23/24 (95.83%), Query Frame = 0
BLAST of MC07g0008 vs. ExPASy Swiss-Prot
Match: B0Z531 (NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Oenothera glazioviana OX=482428 GN=ndhK PE=3 SV=1) HSP 1 Score: 52.4 bits (124), Expect = 1.2e-06 Identity = 22/24 (91.67%), Postives = 23/24 (95.83%), Query Frame = 0
BLAST of MC07g0008 vs. NCBI nr
Match: YP_009439895.1 (NADH dehydrogenase subunit K [Gynostemma caulopterum] >YP_009468865.1 NADH dehydrogenase subunit K [Gynostemma compressum] >ATG86753.1 NADH dehydrogenase subunit K [Gynostemma caulopterum] >AVA29844.1 NADH dehydrogenase subunit K [Gynostemma compressum]) HSP 1 Score: 56.2 bits (134), Expect = 5.92e-08 Identity = 27/34 (79.41%), Postives = 28/34 (82.35%), Query Frame = 0
BLAST of MC07g0008 vs. NCBI nr
Match: YP_009753878.1 (NADH dehydrogenase subunit K [Trichosanthes lobata] >QIT05826.1 NADH dehydrogenase subunit K [Trichosanthes lobata]) HSP 1 Score: 55.5 bits (132), Expect = 1.14e-07 Identity = 26/34 (76.47%), Postives = 28/34 (82.35%), Query Frame = 0
BLAST of MC07g0008 vs. NCBI nr
Match: YP_009945421.1 (NADH-plastoquinone oxidoreductase subunit K [Sechium edule] >QOE55951.1 NADH-plastoquinone oxidoreductase subunit K [Sechium edule]) HSP 1 Score: 55.5 bits (132), Expect = 1.14e-07 Identity = 26/34 (76.47%), Postives = 28/34 (82.35%), Query Frame = 0
BLAST of MC07g0008 vs. NCBI nr
Match: QIT04137.1 (NADH dehydrogenase subunit K [Sechium edule]) HSP 1 Score: 55.5 bits (132), Expect = 1.14e-07 Identity = 26/34 (76.47%), Postives = 28/34 (82.35%), Query Frame = 0
BLAST of MC07g0008 vs. NCBI nr
Match: YP_009430631.1 (NADH dehydrogenase subunit K [Gynostemma cardiospermum] >YP_009439808.1 NADH dehydrogenase subunit K [Gynostemma laxiflorum] >YP_010015143.1 NADH dehydrogenase subunit K [Gynostemma yixingense] >ART65086.1 NADH dehydrogenase subunit K [Gynostemma cardiospermum] >ATG86666.1 NADH dehydrogenase subunit K [Gynostemma laxiflorum] >QOI14268.1 NADH dehydrogenase subunit K [Gynostemma yixingense]) HSP 1 Score: 55.5 bits (132), Expect = 1.14e-07 Identity = 26/34 (76.47%), Postives = 28/34 (82.35%), Query Frame = 0
BLAST of MC07g0008 vs. ExPASy TrEMBL
Match: A0A2L0WR52 (NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Gynostemma compressum OX=1348125 GN=ndhK PE=3 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 2.87e-08 Identity = 27/34 (79.41%), Postives = 28/34 (82.35%), Query Frame = 0
BLAST of MC07g0008 vs. ExPASy TrEMBL
Match: A0A291IAN2 (NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Gynostemma caulopterum OX=1592219 GN=ndhK PE=3 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 2.87e-08 Identity = 27/34 (79.41%), Postives = 28/34 (82.35%), Query Frame = 0
BLAST of MC07g0008 vs. ExPASy TrEMBL
Match: A0A218KG48 (NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Cucumis sativus var. hardwickii OX=319220 GN=ndhK PE=3 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 5.54e-08 Identity = 26/34 (76.47%), Postives = 28/34 (82.35%), Query Frame = 0
BLAST of MC07g0008 vs. ExPASy TrEMBL
Match: A0A410HF89 (NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Trichosanthes kirilowii OX=3677 GN=ndhK PE=3 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 5.54e-08 Identity = 26/34 (76.47%), Postives = 28/34 (82.35%), Query Frame = 0
BLAST of MC07g0008 vs. ExPASy TrEMBL
Match: A0A1X9Q1M2 (NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Cucumis sativus OX=3659 GN=ndhK PE=3 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 5.54e-08 Identity = 26/34 (76.47%), Postives = 28/34 (82.35%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|