MC06g1114 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ACTAAAACTAGGGTTAATAATTTTCAAATAATTGAAAAAATCGATAAGAAAGATTTTTTTTGTCTCACAATTAATCAAGATCAAGAAATCAACCCATCCAACAATAAAAAA ACTAAAACTAGGGTTAATAATTTTCAAATAATTGAAAAAATCGATAAGAAAGATTTTTTTTGTCTCACAATTAATCAAGATCAAGAAATCAACCCATCCAACAATAAAAAA ACTAAAACTAGGGTTAATAATTTTCAAATAATTGAAAAAATCGATAAGAAAGATTTTTTTTGTCTCACAATTAATCAAGATCAAGAAATCAACCCATCCAACAATAAAAAA TKTRVNNFQIIEKIDKKDFFCLTINQDQEINPSNNKK Homology
BLAST of MC06g1114 vs. ExPASy Swiss-Prot
Match: Q09WW0 (Protein TIC 214 OS=Morus indica OX=248361 GN=TIC214 PE=3 SV=1) HSP 1 Score: 49.3 bits (116), Expect = 1.1e-05 Identity = 23/36 (63.89%), Postives = 28/36 (77.78%), Query Frame = 0
BLAST of MC06g1114 vs. ExPASy Swiss-Prot
Match: Q3C1P6 (Protein TIC 214 OS=Nicotiana sylvestris OX=4096 GN=TIC214 PE=3 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 2.4e-05 Identity = 23/37 (62.16%), Postives = 29/37 (78.38%), Query Frame = 0
BLAST of MC06g1114 vs. ExPASy Swiss-Prot
Match: P12222 (Protein TIC 214 OS=Nicotiana tabacum OX=4097 GN=TIC214 PE=3 SV=2) HSP 1 Score: 48.1 bits (113), Expect = 2.4e-05 Identity = 23/37 (62.16%), Postives = 29/37 (78.38%), Query Frame = 0
BLAST of MC06g1114 vs. ExPASy Swiss-Prot
Match: Q8S8U2 (Protein TIC 214 OS=Atropa belladonna OX=33113 GN=TIC214 PE=3 SV=1) HSP 1 Score: 44.3 bits (103), Expect = 3.5e-04 Identity = 22/37 (59.46%), Postives = 27/37 (72.97%), Query Frame = 0
BLAST of MC06g1114 vs. ExPASy Swiss-Prot
Match: Q4VZL0 (Protein TIC 214 OS=Cucumis sativus OX=3659 GN=TIC214 PE=3 SV=2) HSP 1 Score: 43.9 bits (102), Expect = 4.6e-04 Identity = 21/31 (67.74%), Postives = 26/31 (83.87%), Query Frame = 0
BLAST of MC06g1114 vs. NCBI nr
Match: YP_009738261.1 (Ycf1 [Siraitia siamensis] >QIB71654.1 Ycf1 [Siraitia siamensis]) HSP 1 Score: 71.2 bits (173), Expect = 5.78e-13 Identity = 35/37 (94.59%), Postives = 35/37 (94.59%), Query Frame = 0
BLAST of MC06g1114 vs. NCBI nr
Match: QDL00004.1 (Ycf1 [Siraitia grosvenorii] >QIB71566.1 Ycf1 [Siraitia grosvenorii]) HSP 1 Score: 71.2 bits (173), Expect = 5.78e-13 Identity = 35/37 (94.59%), Postives = 35/37 (94.59%), Query Frame = 0
BLAST of MC06g1114 vs. NCBI nr
Match: YP_009752881.1 (Ycf1 protein [Baijiania yunnanensis] >QIT05953.1 Ycf1 protein [Baijiania yunnanensis]) HSP 1 Score: 71.2 bits (173), Expect = 5.78e-13 Identity = 35/37 (94.59%), Postives = 35/37 (94.59%), Query Frame = 0
BLAST of MC06g1114 vs. NCBI nr
Match: YP_009674449.1 (photosystem I assembly protein Ycf1 [Siraitia grosvenorii] >QDK59448.1 photosystem I assembly protein Ycf1 [Siraitia grosvenorii]) HSP 1 Score: 71.2 bits (173), Expect = 5.78e-13 Identity = 35/37 (94.59%), Postives = 35/37 (94.59%), Query Frame = 0
BLAST of MC06g1114 vs. NCBI nr
Match: YP_009753231.1 (Ycf1 protein [Trichosanthes truncata] >QIT06303.1 Ycf1 protein [Trichosanthes truncata]) HSP 1 Score: 70.5 bits (171), Expect = 1.08e-12 Identity = 34/37 (91.89%), Postives = 35/37 (94.59%), Query Frame = 0
BLAST of MC06g1114 vs. ExPASy TrEMBL
Match: A0A515BLT2 (Protein TIC 214 OS=Siraitia grosvenorii OX=190515 GN=ycf1 PE=3 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 2.80e-13 Identity = 35/37 (94.59%), Postives = 35/37 (94.59%), Query Frame = 0
BLAST of MC06g1114 vs. ExPASy TrEMBL
Match: A0A6C0U995 (Protein TIC 214 OS=Siraitia siamensis OX=2695833 GN=ycf1 PE=3 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 2.80e-13 Identity = 35/37 (94.59%), Postives = 35/37 (94.59%), Query Frame = 0
BLAST of MC06g1114 vs. ExPASy TrEMBL
Match: A0A6H0EVE2 (Protein TIC 214 OS=Baijiania yunnanensis OX=381650 GN=ycf1 PE=3 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 2.80e-13 Identity = 35/37 (94.59%), Postives = 35/37 (94.59%), Query Frame = 0
BLAST of MC06g1114 vs. ExPASy TrEMBL
Match: A0A514YKY6 (Protein TIC 214 OS=Siraitia grosvenorii OX=190515 GN=ycf1 PE=3 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 2.80e-13 Identity = 35/37 (94.59%), Postives = 35/37 (94.59%), Query Frame = 0
BLAST of MC06g1114 vs. ExPASy TrEMBL
Match: A0A6H0EWE4 (Protein TIC 214 OS=Trichosanthes truncata OX=685060 GN=ycf1 PE=3 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 5.23e-13 Identity = 34/37 (91.89%), Postives = 35/37 (94.59%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|