MC06g0506 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCTTCTCGCTGCGAGATCTTCTGCGAGATTCTCATCGCTATCTTGATTCCTCCTTTGGGCGTCTGCCTCAGGCACGGATGTTGTACTGTAAGCTTCTGATTCTTTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCGCTCTTTTATTTCTGTTACTCTCATTAATTGCATAGATTCTGATTAACGATTGTTGTAATTGCAGGTTGAGTTTTGTATATGCCTTCTCTTGACGTTTCTCGGTTATATTCCTGGAATAATCTACGCCTTGTATGCCATCGTTTTCATTGATCGCGATCAGTACTTCGATGAATATAGGCGTCCTCTGTAT ATGCCTTCTCGCTGCGAGATCTTCTGCGAGATTCTCATCGCTATCTTGATTCCTCCTTTGGGCGTCTGCCTCAGGCACGGATGTTGTACTGTTGAGTTTTGTATATGCCTTCTCTTGACGTTTCTCGGTTATATTCCTGGAATAATCTACGCCTTGTATGCCATCGTTTTCATTGATCGCGATCAGTACTTCGATGAATATAGGCGTCCTCTGTAT ATGCCTTCTCGCTGCGAGATCTTCTGCGAGATTCTCATCGCTATCTTGATTCCTCCTTTGGGCGTCTGCCTCAGGCACGGATGTTGTACTGTTGAGTTTTGTATATGCCTTCTCTTGACGTTTCTCGGTTATATTCCTGGAATAATCTACGCCTTGTATGCCATCGTTTTCATTGATCGCGATCAGTACTTCGATGAATATAGGCGTCCTCTGTAT MPSRCEIFCEILIAILIPPLGVCLRHGCCTVEFCICLLLTFLGYIPGIIYALYAIVFIDRDQYFDEYRRPLY Homology
BLAST of MC06g0506 vs. ExPASy Swiss-Prot
Match: O82232 (UPF0057 membrane protein At2g24040 OS=Arabidopsis thaliana OX=3702 GN=At2g24040 PE=3 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 2.6e-27 Identity = 55/72 (76.39%), Postives = 64/72 (88.89%), Query Frame = 0
BLAST of MC06g0506 vs. ExPASy Swiss-Prot
Match: Q9SUI0 (UPF0057 membrane protein At4g30660 OS=Arabidopsis thaliana OX=3702 GN=At4g30660 PE=3 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 2.6e-27 Identity = 55/72 (76.39%), Postives = 63/72 (87.50%), Query Frame = 0
BLAST of MC06g0506 vs. ExPASy Swiss-Prot
Match: Q9M095 (UPF0057 membrane protein At4g30650 OS=Arabidopsis thaliana OX=3702 GN=At4g30650 PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 3.1e-20 Identity = 47/61 (77.05%), Postives = 53/61 (86.89%), Query Frame = 0
BLAST of MC06g0506 vs. ExPASy Swiss-Prot
Match: Q9LRI7 (Hydrophobic protein OSR8 OS=Oryza sativa subsp. japonica OX=39947 GN=OSR8 PE=3 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 9.9e-19 Identity = 44/64 (68.75%), Postives = 53/64 (82.81%), Query Frame = 0
BLAST of MC06g0506 vs. ExPASy Swiss-Prot
Match: A2Y075 (Hydrophobic protein LTI6B OS=Oryza sativa subsp. indica OX=39946 GN=LTI6B PE=3 SV=2) HSP 1 Score: 65.5 bits (158), Expect = 2.9e-10 Identity = 35/46 (76.09%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MC06g0506 vs. NCBI nr
Match: XP_022135490.1 (UPF0057 membrane protein At4g30660-like [Momordica charantia]) HSP 1 Score: 152 bits (383), Expect = 2.49e-46 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 0
BLAST of MC06g0506 vs. NCBI nr
Match: XP_008443846.1 (PREDICTED: UPF0057 membrane protein At4g30660 [Cucumis melo]) HSP 1 Score: 150 bits (379), Expect = 1.01e-45 Identity = 70/72 (97.22%), Postives = 72/72 (100.00%), Query Frame = 0
BLAST of MC06g0506 vs. NCBI nr
Match: XP_004146673.1 (UPF0057 membrane protein At4g30660 [Cucumis sativus] >KGN65173.1 hypothetical protein Csa_019763 [Cucumis sativus]) HSP 1 Score: 148 bits (374), Expect = 5.88e-45 Identity = 69/72 (95.83%), Postives = 72/72 (100.00%), Query Frame = 0
BLAST of MC06g0506 vs. NCBI nr
Match: XP_038879686.1 (UPF0057 membrane protein At4g30660-like [Benincasa hispida]) HSP 1 Score: 148 bits (373), Expect = 8.36e-45 Identity = 69/72 (95.83%), Postives = 71/72 (98.61%), Query Frame = 0
BLAST of MC06g0506 vs. NCBI nr
Match: XP_021814013.1 (UPF0057 membrane protein At4g30660-like [Prunus avium]) HSP 1 Score: 147 bits (371), Expect = 1.74e-44 Identity = 67/72 (93.06%), Postives = 71/72 (98.61%), Query Frame = 0
BLAST of MC06g0506 vs. ExPASy TrEMBL
Match: A0A6J1C169 (UPF0057 membrane protein At4g30660-like OS=Momordica charantia OX=3673 GN=LOC111007433 PE=3 SV=1) HSP 1 Score: 152 bits (383), Expect = 1.20e-46 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 0
BLAST of MC06g0506 vs. ExPASy TrEMBL
Match: A0A1S3B9R0 (UPF0057 membrane protein At4g30660 OS=Cucumis melo OX=3656 GN=LOC103487341 PE=3 SV=1) HSP 1 Score: 150 bits (379), Expect = 4.91e-46 Identity = 70/72 (97.22%), Postives = 72/72 (100.00%), Query Frame = 0
BLAST of MC06g0506 vs. ExPASy TrEMBL
Match: A0A0A0LTR2 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G257300 PE=3 SV=1) HSP 1 Score: 148 bits (374), Expect = 2.85e-45 Identity = 69/72 (95.83%), Postives = 72/72 (100.00%), Query Frame = 0
BLAST of MC06g0506 vs. ExPASy TrEMBL
Match: A0A314Z9A4 (UPF0057 membrane protein OS=Prunus yedoensis var. nudiflora OX=2094558 GN=Pyn_21988 PE=3 SV=1) HSP 1 Score: 147 bits (371), Expect = 8.41e-45 Identity = 67/72 (93.06%), Postives = 71/72 (98.61%), Query Frame = 0
BLAST of MC06g0506 vs. ExPASy TrEMBL
Match: A0A6P5SJT5 (UPF0057 membrane protein At4g30660-like OS=Prunus avium OX=42229 GN=LOC110756847 PE=3 SV=1) HSP 1 Score: 147 bits (371), Expect = 8.41e-45 Identity = 67/72 (93.06%), Postives = 71/72 (98.61%), Query Frame = 0
BLAST of MC06g0506 vs. TAIR 10
Match: AT4G28088.1 (Low temperature and salt responsive protein family ) HSP 1 Score: 127.5 bits (319), Expect = 4.4e-30 Identity = 58/72 (80.56%), Postives = 66/72 (91.67%), Query Frame = 0
BLAST of MC06g0506 vs. TAIR 10
Match: AT2G24040.1 (Low temperature and salt responsive protein family ) HSP 1 Score: 122.1 bits (305), Expect = 1.8e-28 Identity = 55/72 (76.39%), Postives = 64/72 (88.89%), Query Frame = 0
BLAST of MC06g0506 vs. TAIR 10
Match: AT4G30660.1 (Low temperature and salt responsive protein family ) HSP 1 Score: 122.1 bits (305), Expect = 1.8e-28 Identity = 55/72 (76.39%), Postives = 63/72 (87.50%), Query Frame = 0
BLAST of MC06g0506 vs. TAIR 10
Match: AT4G30660.2 (Low temperature and salt responsive protein family ) HSP 1 Score: 122.1 bits (305), Expect = 1.8e-28 Identity = 55/72 (76.39%), Postives = 63/72 (87.50%), Query Frame = 0
BLAST of MC06g0506 vs. TAIR 10
Match: AT4G30650.1 (Low temperature and salt responsive protein family ) HSP 1 Score: 98.6 bits (244), Expect = 2.2e-21 Identity = 47/61 (77.05%), Postives = 53/61 (86.89%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|